Protein on Demand™ CYP11B2 Recombinant Protein (Mouse) (OPCA17207)

Datasheets/Manuals	Printable datasheet for OPCA17207

Product Info
Predicted Species Reactivity	Mouse
Product Format	Liquid
Application	WB, ELISA
Reconstitution and Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Purity	Greater than 85% as determined by SDS-PAGE.
Protein Sequence	GTTATLAPKTLQPFEAIPQYSRNKWLKMIQILREQGQENLHLEMHQVFRELGPIFRHSVGKTQIVSVMLPEDAEKLHQVESMLPRRMHLEPWVAHRELRGLRRGVFLLNGPEWRLNRLRLNRNVLSPKAVQKFVPMVDMVARDFLETLKEKVLQNARGSLTMDVQQSLFNYTIEASNFALFGERLGLLGHDLSPGSLKFIHALHSMFKSTSQLLFLPKSLTRWTSTRVWKEHFDAWDVISEYANRCIWKVHQELRLGSSQTYSGIVAELISQGSLPLDAIKANSMELTAGSVDTTAIPLVMTLFELARNPDVQKALRQESLAAEASIAANPQKAMSDLPLLRAALKETLRLYPVGGFLERILSSDLVLQNYHVPAGTLVLLYLYSMGRNPAVFPRPERYMPQRWLERKRSFQHLAFGFGVRQCLGRRLAEVEMMLLLHHILKTFQVETLRQEDVQMAYRFVLMPSSSPVLTFRPVS
Storage Buffer	Tris-based buffer,50% glycerol
Protein Range	25-500

Gene Full Name	cytochrome P450, family 11, subfamily b, polypeptide 2
Alias Symbols	Cpn2, Cyp11b, Cyp11b-2
NCBI Gene Id	13072
Protein Name	cytochrome P450 11B2, mitochondrial
Uniprot ID	P15539
Protein Size (# AA)	476