CYP11B2 Recombinant Protein (Human ) (OPCA05172)

Catalog No: OPCA05172

Product Info

• Predicted Species Reactivity: Homo sapiens|Human
• Product Format: Liquid or Lyophilized powder
• Additional Information: Species Specificity Detail: Homo sapiens (Human)
• Reconstitution and Storage: -20°C or -80°C
• Formulation: Tris-base, 50% glycerol
• Purity: Greater than 90% as determined by SDS-PAGE.
• Peptide Sequence: GTRAARAPRTVLPFEAMPQHPGNRWLRLLQIWREQGYEHLHLEMHQTFQELGPIFRYNLGGPRMVCVMLPEDVEKLQQVDSLHPCRMILEPWVAYRQHRGHKCGVFLLNGPEWRFNRLRLNPDVLSPKAVQRFLPMVDAVARDFSQALKKKVLQNARGSLTLDVQPSIFHYTIEASNLALFGERLGLVGHSPSSASLNFLHALEVMFKSTVQLMFMPRSLSRWISPKVWKEHFEAWDCIFQYGDNCIQKIYQELAFNRPQHYTGIVAELLLKAELSLEAIKANSMELTAGSVDTTAFPLLMTLFELARNPDVQQILRQESLAAAASISEHPQKATTELPLLRAALKETLRLYPVGLFLERVVSSDLVLQNYHIPAGTLVQVFLYSLGRNAALFPRPERYNPQRWLDIRGSGRNFHHVPFGFGMRQCLGRRLAEAEMLLLLHHVLKHFLVETLTQEDIKMVYSFILRPGTSPLLTFRAIN
• Protein Sequence: GTRAARAPRTVLPFEAMPQHPGNRWLRLLQIWREQGYEHLHLEMHQTFQELGPIFRYNLGGPRMVCVMLPEDVEKLQQVDSLHPCRMILEPWVAYRQHRGHKCGVFLLNGPEWRFNRLRLNPDVLSPKAVQRFLPMVDAVARDFSQALKKKVLQNARGSLTLDVQPSIFHYTIEASNLALFGERLGLVGHSPSSASLNFLHALEVMFKSTVQLMFMPRSLSRWISPKVWKEHFEAWDCIFQYGDNCIQKIYQELAFNRPQHYTGIVAELLLKAELSLEAIKANSMELTAGSVDTTAFPLLMTLFELARNPDVQQILRQESLAAAASISEHPQKATTELPLLRAALKETLRLYPVGLFLERVVSSDLVLQNYHIPAGTLVQVFLYSLGRNAALFPRPERYNPQRWLDIRGSGRNFHHVPFGFGMRQCLGRRLAEAEMLLLLHHVLKHFLVETLTQEDIKMVYSFILRPGTSPLLTFRAIN
• Storage Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Yeast
• Protein Range: 25-503 aa
• Tag: N-terminal 6xHis-tagged
• Reference: Congenitally defective aldosterone biosynthesis in humans: the involvement of point mutations of the P-450C18 gene (CYP11B2) in CMO II deficient patients. Mitsuuchi Y., Kawamoto T., Naiki Y., Miyahara K., Toda K., Kuribayashi I., Orii T., Yasuda K., Miura K., Nakao K., Imura H., Ulick S., Shizuta Y. Biochem. Biophys. Res. Commun. 182:974-979(1992)

Target Info

• Gene Symbol: CYP11B2
• Gene Full Name: cytochrome P450 family 11 subfamily B member 2
• Alias Symbols: ALDOS;aldosterone synthase;aldosterone-synthesizing enzyme;corticosterone 18-monooxygenase, CYP11B2;CPN2;CYP11B;CYP11BL;CYPXIB2;cytochrome P450 11B2, mitochondrial;cytochrome P450, family 11, subfamily B, polypeptide 2;cytochrome P450, subfamily XIB (steroid 11-beta-hydroxylase), polypeptide 2;cytochrome P-450Aldo;cytochrome P-450C18;mitochondrial cytochrome P450, family 11, subfamily B, polypeptide 2;P450aldo;P450C18;P-450C18;steroid 11-beta/18-hydroxylase;steroid 11-beta-hydroxylase, CYP11B2;steroid 11-beta-monooxygenase;Steroid 18-hydroxylase;steroid 18-hydroxylase, aldosterone synthase, P450C18, P450aldo.
• NCBI Gene Id: 1585
• Protein Name: Cytochrome P450 11B2, mitochondrial
• Description of Target: Preferentially catalyzes the conversion of 11-deoxycorticosterone to aldosterone via corticosterone and 18-hydroxycorticosterone.
• Uniprot ID: P19099
• Protein Accession #: NP_000489
• Nucleotide Accession #: NM_000498
• Protein Size (# AA): Recombinant
• Molecular Weight: 57 kDa