Catalog No: OPCA17205
Price: $0.00
SKU
OPCA17205
Availability: Domestic: within 4-8 weeks delivery International: 4-8 weeks
Contact Us:
- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
Shipping Info:
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
Protein on Demand™ CYP11B1 Recombinant Protein (Human) (OPCA17205)
Datasheets/Manuals | Printable datasheet for OPCA17205 |
---|
Predicted Species Reactivity | Human |
---|---|
Product Format | Liquid |
Application | WB, ELISA |
Reconstitution and Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Purity | Greater than 85% as determined by SDS-PAGE. |
Protein Sequence | GTRAARVPRTVLPFEAMPRRPGNRWLRLLQIWREQGYEDLHLEVHQTFQELGPIFRYDLGGAGMVCVMLPEDVEKLQQVDSLHPHRMSLEPWVAYRQHRGHKCGVFLLNGPEWRFNRLRLNPEVLSPNAVQRFLPMVDAVARDFSQALKKKVLQNARGSLTLDVQPSIFHYTIEASNLALFGERLGLVGHSPSSASLNFLHALEVMFKSTVQLMFMPRSLSRWTSPKVWKEHFEAWDCIFQYGDNCIQKIYQELAFSRPQQYTSIVAELLLNAELSPDAIKANSMELTAGSVDTTVFPLLMTLFELARNPNVQQALRQESLAAAASISEHPQKATTELPLLRAALKETLRLYPVGLFLERVASSDLVLQNYHIPAGTLVRVFLYSLGRNPALFPRPERYNPQRWLDIRGSGRNFYHVPFGFGMRQCLGRRLAEAEMLLLLHHVLKHLQVETLTQEDIKMVYSFILRPSMFPLLTFRAIN |
Storage Buffer | Tris-based buffer,50% glycerol |
Protein Range | 25-503 |
Gene Full Name | cytochrome P450 family 11 subfamily B member 1 |
---|---|
Alias Symbols | FHI, CPN1, CYP11B, P450C11 |
NCBI Gene Id | 1584 |
Protein Name | cytochrome P450 11B1, mitochondrial |
Description of Target | This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein local |
Uniprot ID | P15538 |
Protein Accession # | NP_000488.3 |
Nucleotide Accession # | NM_000497.3 |
Protein Size (# AA) | 479 |
Write Your Own Review