Size:100 ul
Special Price $229.00 Regular Price $289.00
In stock
SKU
ARP51993_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP51993_P050-FITC Conjugated

ARP51993_P050-HRP Conjugated

ARP51993_P050-Biotin Conjugated

Cyc1 Antibody - C-terminal region (ARP51993_P050)

Catalog#: ARP51993_P050
Domestic: within 1-2 days delivery International: 1-2 days
More Information
Tested Species Reactivity Mouse
Predicted Species Reactivity Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rat, Zebrafish
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-514435 from Santa Cruz Biotechnology.
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Goat: 83%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Zebrafish: 93%
Complete computational species homology data Anti-Cyc1 (ARP51993_P050)
Peptide Sequence Synthetic peptide located within the following region: GGEDYVFSLLTGYCEPPTGVSLREGLYFNPYFPGQAIGMAPPIYTEVLEY
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-Cyc1 (ARP51993_P050) antibody is Catalog # AAP51993
Datasheets/Manuals Printable datasheet for anti-Cyc1 (ARP51993_P050) antibody
Publications

Qattan, A. T., Radulovic, M., Crawford, M. & Godovac-Zimmermann, J. Spatial distribution of cellular function: the partitioning of proteins between mitochondria and the nucleus in MCF7 breast cancer cells. J. Proteome Res. 11, 6080-101 (2012). WB, Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rat, Zebrafish 23051583

Gene Symbol Cyc1
Official Gene Full Name Cytochrome c-1
Alias Symbols 2610002H19Rik, AA408921
NCBI Gene Id 66445
Protein Name Cytochrome c1, heme protein, mitochondrial
Description of Target The function of this protein is unknown.
Swissprot Id Q9D0M3
Protein Accession # NP_079843
Nucleotide Accession # NM_025567
Protein Size (# AA) 325
Molecular Weight 36kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express Cyc1.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express Cyc1.
Protein Interactions SNCA;
Write Your Own Review
You're reviewing:Cyc1 Antibody - C-terminal region (ARP51993_P050)
Your Rating