Search Antibody, Protein, and ELISA Kit Solutions

Cyc1 Antibody - C-terminal region (ARP51993_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP51993_P050-FITC Conjugated

ARP51993_P050-HRP Conjugated

ARP51993_P050-Biotin Conjugated

Gene Symbol:
Official Gene Full Name:
Cytochrome c-1
NCBI Gene Id:
Protein Name:
Cytochrome c1, heme protein, mitochondrial
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
2610002H19Rik, AA408921
Replacement Item:
This antibody may replace item sc-514435 from Santa Cruz Biotechnology.
Description of Target:
The function of this protein is unknown.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express Cyc1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express Cyc1.
Predicted Species Reactivity:
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rat, Zebrafish
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Goat: 83%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Zebrafish: 93%
Complete computational species homology data:
Anti-Cyc1 (ARP51993_P050)
Peptide Sequence:
Synthetic peptide located within the following region: GGEDYVFSLLTGYCEPPTGVSLREGLYFNPYFPGQAIGMAPPIYTEVLEY
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-Cyc1 (ARP51993_P050) antibody is Catalog # AAP51993
Printable datasheet for anti-Cyc1 (ARP51993_P050) antibody

Qattan, A. T., Radulovic, M., Crawford, M. & Godovac-Zimmermann, J. Spatial distribution of cellular function: the partitioning of proteins between mitochondria and the nucleus in MCF7 breast cancer cells. J. Proteome Res. 11, 6080-101 (2012). WB, Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rat, Zebrafish 23051583

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...