CYBB Recombinant Protein (Human) (OPCA03840)

Catalog No: OPCA03840

Product Info

• Predicted Species Reactivity: Homo sapiens|Human
• Product Format: Liquid or Lyophilized powder
• Additional Information: Species Specificity Detail: Homo sapiens (Human)
• Reconstitution and Storage: -20°C or -80°C
• Formulation: Tris-base, 50% glycerol
• Purity: Greater than 90% as determined by SDS-PAGE.
• Peptide Sequence: ERLVRFWRSQQKVVITKVVTHPFKTIELQMKKKGFKMEVGQYIFVKCPKVSKLEWHPFTLTSAPEEDFFSIHIRIVGDWTEGLFNACGCDKQEFQDAWKLPKIAVDGPFGTASEDVFSYEVVMLVGAGIGVTPFASILKSVWYKYCNNATNLKLKKIYFYWLCRDTHAFEWFADLLQLLESQMQERNNAGFLSYNIYLTGWDESQANHFAVHHDEEKDVITGLKQKTLYGRPNWDNEFKTIASQHPNTRIGVFLCGPEALAETLSKQSISNSESGPRGVHFIFNKENF
• Protein Sequence: ERLVRFWRSQQKVVITKVVTHPFKTIELQMKKKGFKMEVGQYIFVKCPKVSKLEWHPFTLTSAPEEDFFSIHIRIVGDWTEGLFNACGCDKQEFQDAWKLPKIAVDGPFGTASEDVFSYEVVMLVGAGIGVTPFASILKSVWYKYCNNATNLKLKKIYFYWLCRDTHAFEWFADLLQLLESQMQERNNAGFLSYNIYLTGWDESQANHFAVHHDEEKDVITGLKQKTLYGRPNWDNEFKTIASQHPNTRIGVFLCGPEALAETLSKQSISNSESGPRGVHFIFNKENF
• Storage Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: E.coli
• Protein Range: 283-570 aa
• Tag: N-terminal 6xHis-tagged
• Reference: The glycoprotein encoded by the X-linked chronic granulomatous disease locus is a component of the neutrophil cytochrome b complex. Dinauer M.C., Orkin S.H., Brown R., Jesaitis A.J., Parkos C.A. Nature 327:717-720(1987)

Target Info

• Gene Symbol: CYBB
• Gene Full Name: cytochrome b-245 beta chain
• Alias Symbols: AMCBX2;CGD;CGD91-phox;CGDX;cytochrome b(558) subunit beta;cytochrome b-245 beta polypeptide;cytochrome b-245 heavy chain;cytochrome b558 subunit beta;GP91-1;GP91PHOX;GP91-PHOX;heme-binding membrane glycoprotein gp91phox;IMD34;NADPH oxidase 2;neutrophil cytochrome b 91 kDa polypeptide;NOX2;p22 phagocyte B-cytochrome;p91-PHOX;superoxide-generating NADPH oxidase heavy chain subunit.
• NCBI Gene Id: 1536
• Protein Name: Cytochrome b-245 heavy chain
• Description of Target: Critical component of the membrane-bound oxidase of phagocytes that generates superoxide. It is the terminal component of a respiratory chain that transfers single electrons from cytoplasmic NADPH across the plasma membrane to molecular oxygen on the exterior. Also functions as a voltage-gated proton channel that mediates the H(+) currents of resting phagocytes. It participates in the regulation of cellular pH and is blocked by zinc.
• Uniprot ID: P04839
• Protein Accession #: NP_000388
• Nucleotide Accession #: NM_000397
• Protein Size (# AA): Recombinant
• Molecular Weight: 37.2 kDa