CYBA Antibody - middle region (ARP44214_P050)

Catalog No: ARP44214_P050

WB Suggested Anti-CYBA Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Human Small Intestine

Rabbit Anti-CYBA Antibody
Catalog Number: ARP44214_P050
Formalin Fixed Paraffin Embedded Tissue: Human heart Tissue
Observed Staining: Plasma membrane in intercalated disk
Primary Antibody Concentration: 1:100
Other Working Concentrations: N/A
Secondary Antibody: Donkey anti-Rabbit-Cy3
Secondary Antibody Concentration: 1:200
Magnification: 20X
Exposure Time: 0.5 - 2.0 sec

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit, Sheep
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB, IHC
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CYBA
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 93%; Dog: 79%; Horse: 79%; Human: 100%; Mouse: 86%; Pig: 86%; Rabbit: 79%; Rat: 86%; Sheep: 93%
• Peptide Sequence: Synthetic peptide located within the following region: TILGTACLAIASGIYLLAAVRGEQWTPIEPKPRERPQIGGTIKQPPSNPP
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-CYBA (ARP44214_P050) antibody is Catalog # AAP44214 (Previous Catalog # AAPP11990)

Target Info

• Gene Symbol: CYBA
• Gene Full Name: Cytochrome b-245, alpha polypeptide
• Alias Symbols: CGD4, p22-PHOX
• NCBI Gene Id: 1535
• Protein Name: Cytochrome b-245 light chain
• Description of Target: Cytochrome b is comprised of a light chain (alpha) and a heavy chain (beta). This gene encodes the light, alpha subunit which has been proposed as a primary component of the microbicidal oxidase system of phagocytes. Mutations in this gene are associated
• Uniprot ID: P13498
• Protein Accession #: NP_000092
• Nucleotide Accession #: NM_000101
• Protein Size (# AA): 195
• Molecular Weight: 21kDa
• Protein Interactions: RBPMS; PSMA3; UPF2; RCHY1; UBC; MDFI; CPT1A; NCF1; VHL; RAC1; NCF4; CYBB; NOX1; NCF2;