CYB5R3 Antibody - middle region (ARP85036_P050)

Catalog No: ARP85036_P050

Host: Rabbit
Target Name: CYB5R3
Sample Tissue: Human Mesenchymoma Tumor lysates
Antibody Dilution: 1ug/ml

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CYB5R3
• Purification: Affinity purified
• Peptide Sequence: Synthetic peptide located within the following region: IDGNLVVRPYTPISSDDDKGFVDLVIKVYFKDTHPKFPAGGKMSQYLESM
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-CYB5R3 (ARP85036_P050) antibody is Catalog # AAP85036

Target Info

• Gene Symbol: CYB5R3
• Gene Full Name: cytochrome b5 reductase 3
• Alias Symbols: B5R, DIA1
• NCBI Gene Id: 1727
• Protein Name: NADH-cytochrome b5 reductase 3
• Description of Target: This gene encodes cytochrome b5 reductase, which includes a membrane-bound form in somatic cells (anchored in the endoplasmic reticulum, mitochondrial and other membranes) and a soluble form in erythrocytes. The membrane-bound form exists mainly on the cytoplasmic side of the endoplasmic reticulum and functions in desaturation and elongation of fatty acids, in cholesterol biosynthesis, and in drug metabolism. The erythrocyte form is located in a soluble fraction of circulating erythrocytes and is involved in methemoglobin reduction. The membrane-bound form has both membrane-binding and catalytic domains, while the soluble form has only the catalytic domain. Alternate splicing results in multiple transcript variants. Mutations in this gene cause methemoglobinemias.
• Uniprot ID: P00387
• Protein Accession #: NP_000389.1
• Nucleotide Accession #: NM_000398.6
• Protein Size (# AA): 301
• Molecular Weight: 33 kDa