CYANOVIRIN-N HOMOLOG Recombinant Protein (Triangle waterfern) (OPCA04564)

Catalog No: OPCA04564

Product Info

• Predicted Species Reactivity: Ceratopteris richardii
• Product Format: Liquid or Lyophilized powder
• Additional Information: Species Specificity Detail: Ceratopteris richardii (Triangle waterfern)
• Reconstitution and Storage: -20°C or -80°C
• Formulation: Tris-base, 50% glycerol
• Purity: Greater than 90% as determined by SDS-PAGE.
• Peptide Sequence: QCNFANSCTGVELYGYILRGDCINEDGHPHATSINLNYYIGNDNGRLEYPGESFGSSCVKTALNDGHTLTASCKGADGQYHDSSMDLNYVVGNSYGYMEPCRASNADHVLKSSSE
• Protein Sequence: QCNFANSCTGVELYGYILRGDCINEDGHPHATSINLNYYIGNDNGRLEYPGESFGSSCVKTALNDGHTLTASCKGADGQYHDSSMDLNYVVGNSYGYMEPCRASNADHVLKSSSE
• Storage Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Yeast
• Protein Range: 28-142 aa
• Tag: N-terminal 6xHis-tagged

Target Info

• Reference: The evolutionarily conserved family of cyanovirin-N homologs: structures and carbohydrate specificity.Koharudin L.M.I., Viscomi A.R., Jee J.-G., Ottonello S., Gronenborn A.M.Structure 16:570-584(2008)
• Alias Symbols: Cyanovirin-N homolog, CV-N homolog
• Protein Name: Cyanovirin-N homolog
• Description of Target: Mannose-binding lectin.
• Uniprot ID: P86326
• Protein Size (# AA): Recombinant
• Molecular Weight: 14.4 kDa