CY24B Antibody - C-terminal region (ARP44276_P050)

Catalog No: ARP44276_P050

Click here to learn more about Aviva's By-Request Conjugation Service.

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 4 ug/mL of the antibody was used in this experiment.

Surface Plasmon Resonance Kinetic Characterization of Polyclonal Antibody Affinity. Purified polyclonal antibodies were immobilized on a Protein A/G coated Carterra LSA sensor chip (PAGH200M) at concentrations of 5, and 50 ug/mL in duplicate. Antibodies on the surface were exposed to interaction with peptides sequentially via microfluidic controlled flow at 333nM peptide concentration for kinetic characterization of the binders for affinity and specificity, followed by curve fitting using the Kinetics software. Kd determinations for both concentrations were averaged and results and standard deviation are shown.

IHC Information: Lung, Human: Formalin-Fixed, Paraffin-Embedded (FFPE)

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human CY24B
• Purification: Affinity purified
• Predicted Homology Based on Immunogen Sequence: Cow: 79%; Dog: 93%; Horse: 86%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
• Peptide Sequence: Synthetic peptide located within the following region: YGRPNWDNEFKTIASQHPNTRIGVFLCGPEALAETLSKQSISNSESGPRG
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-CY24B (ARP44276_P050) antibody is Catalog # AAP44276
• Enhanced Validation:

  Relative Expression (Western Blot)

• Reference: Fink,K., (2008) J. Immunol. 180 (10), 6911-6922

Target Info

• Gene Symbol: CYBB
• Gene Full Name: cytochrome b-245, beta polypeptide
• Alias Symbols: CGD, NOX2, IMD34, AMCBX2, GP91-1, GP91PHOX, p91-PHOX, GP91-PHOX
• NCBI Gene Id: 1536
• Protein Name: cytochrome b-245 heavy chain
• Description of Target: Cytochrome b (-245) is composed of cytochrome b alpha (CYBA) and beta (CYBB) chain. It has been proposed as a primary component of the microbicidal oxidase system of phagocytes. CYBB deficiency is one of five described biochemical defects associated with chronic granulomatous disease (CGD). In this disorder, there is decreased activity of phagocyte NADPH oxidase; neutrophils are able to phagocytize bacteria but cannot kill them in the phagocytic vacuoles. The cause of the killing defect is an inability to increase the cell's respiration and consequent failure to deliver activated oxygen into the phagocytic vacuole.
• Uniprot ID: P04839
• Protein Accession #: NP_000388
• Nucleotide Accession #: NM_000397.3
• Protein Size (# AA): 570
• Molecular Weight: 62 kDa
• Protein Interactions: IQGAP1; ACTB; UBC; SUMO1; RAC1; NCF4; NCF2; NCF1; CYBA; ACTG1;