CXorf34 Antibody - N-terminal region (ARP48927_P050)

Catalog No: ARP48927_P050

WB Suggested Anti-CXorf34 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Human brain

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Horse, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CXorf34
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Horse: 93%; Human: 100%; Rabbit: 79%
• Peptide Sequence: Synthetic peptide located within the following region: PPGWSQLFLGTVCKGDFTRVIATKCQKGQKSQKKPSHLGPLDGSWQERLA
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-TRMT2B (ARP48927_P050) antibody is Catalog # AAP48927 (Previous Catalog # AAPS23910)

Target Info

• Gene Symbol: TRMT2B
• Gene Full Name: TRM2 tRNA methyltransferase 2 homolog B (S. cerevisiae)
• Alias Symbols: CXorf34, dJ341D10.3
• NCBI Gene Id: 79979
• Protein Name: tRNA (uracil(54)-C(5))-methyltransferase homolog
• Description of Target: TRMT2B (CXorf34) is probable S-adenosyl-L-methionine-dependent methlytransferase that catalyzes the formation of 5-methyl-uridine at position 54 (M-5-U54) in all tRNA. And it may also have a role in tRNA stabilization or maturation.
• Uniprot ID: Q96GJ1
• Protein Accession #: NP_079193
• Nucleotide Accession #: NM_024917
• Protein Size (# AA): 504
• Molecular Weight: 56kDa
• Protein Interactions: ERCC1; UBC;