- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
Datasheets/Manuals | Printable datasheet for CXCR6 Antibody (OAAF08119) |
---|
Predicted Species Reactivity | Human|Mouse|Rat |
---|---|
Clonality | Polyclonal |
Host | Rabbit |
Application | Enzyme-linked immunosorbent assay|Immunofluorescence|Immunohistochemistry-Paraffin|Western blot |
Reconstitution and Storage | -20°C |
Immunogen | The antiserum was produced against synthesized peptide derived from the N-terminal region of human CXCR6. |
Purification | The antibody was affinity-purified from rabbit antiserum by affinity-chromatography using peptide. |
Peptide Sequence | Synthetic peptide located within the following region: MAEHDYHEDYGFSSFNDSSQEEHQDFLQFSKVFLPCMYLVVFVCGLVGNS |
Concentration | 1mg/ml |
Specificity | CXCR6 Antibody detects endogenous levels of CXCR6 protein. |
Formulation | Rabbit IgG in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. |
Application Info | WB: 1:500~1:1000 ELISA: 1:10000 |
Gene Symbol | CXCR6 |
---|---|
Gene Full Name | C-X-C motif chemokine receptor 6 |
Alias Symbols | BONZO;CD186;CDw186;chemokine (C-X-C motif) receptor 6;C-X-C chemokine receptor type 6;G protein-coupled receptor;G-protein coupled receptor bonzo;G-protein coupled receptor STRL33;STRL33;TYMSTR. |
NCBI Gene Id | 10663 |
Protein Name | C-X-C chemokine receptor type 6 |
Description of Target | Receptor for the C-X-C chemokine CXCL16. Used as a coreceptor by SIVs and by strains of HIV-2 and m-tropic HIV-1. |
Uniprot ID | O00574 |
Molecular Weight | 39 kDa |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
-
What is the species homology for "CXCR6 Antibody (OAAF08119)"?
The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human|Mouse|Rat".
-
How long will it take to receive "CXCR6 Antibody (OAAF08119)"?
This item is available "Domestic: within 1-2 week delivery | International: 1-2 weeks".
-
What buffer format is "CXCR6 Antibody (OAAF08119)" provided in?
This item is provided in "".
Additional format options may be available. For more information please contact info@avivasysbio.com. -
What are other names for "CXCR6 Antibody (OAAF08119)"?
This target may also be called "BONZO;CD186;CDw186;chemokine (C-X-C motif) receptor 6;C-X-C chemokine receptor type 6;G protein-coupled receptor;G-protein coupled receptor bonzo;G-protein coupled receptor STRL33;STRL33;TYMSTR." in publications.
-
What is the shipping cost for "CXCR6 Antibody (OAAF08119)"?
The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.
-
What is the guarantee for "CXCR6 Antibody (OAAF08119)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
-
Can I get bulk pricing for "CXCR6 Antibody (OAAF08119)"?
You can get bulk pricing for this item by going here.
-
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "39 kDa".
Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics. -
What protocols are available for "CXCR6 Antibody (OAAF08119)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
-
What are positive controls for "CXCR6"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What are negative controls for "CXCR6"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What other proteins interact with "CXCR6"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
-
What biological processes are associated with "CXCR6"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
-
What cellular components are associated with "CXCR6"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
-
What protein functions are associated with "CXCR6"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.