Loading...
Catalog No: AVARP07030_P050
Price: $0.00
SKU
AVARP07030_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-CXCR6 (AVARP07030_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human CXCR6
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceHuman: 100%
Peptide SequenceSynthetic peptide located within the following region: AEHDYHEDYGFSSFNDSSQEEHQDFLQFSKVFLPCMYLVVFVCGLVGNSL
Concentration0.5 mg/ml
Blocking PeptideFor anti-CXCR6 (AVARP07030_P050) antibody is Catalog # AAP30813 (Previous Catalog # AAPP01477)
ReferenceHu,W., (2008) Cancer Sci. 99 (7), 1362-1369
Gene SymbolCXCR6
Gene Full NameChemokine (C-X-C motif) receptor 6
Alias SymbolsBONZO, CD186, CDw186, STRL33, TYMSTR
NCBI Gene Id10663
Protein NameC-X-C chemokine receptor type 6
Description of TargetCXCR6 is a receptor for the C-X-C chemokine CXCL16. It is used as a coreceptor by SIVs and by strains of HIV-2 and m-tropic HIV-1.The CXCR6/AKT/mTOR pathway plays a central role in the development of prostate cancer. CXCR6 and CXCR3 act coordinately with respective ligands and are involved in the pathophysiology of Juvenile Idiopathic Arthritis-associated inflammatory processes. The CXCL16-CXCR6-system express in human schwannomas of different localization and in malignant peripheral nerve sheath tumors. The protein may play an important role in the retention of T cells within the lung.
Uniprot IDO00574
Protein Accession #NP_006555
Nucleotide Accession #NM_006564
Protein Size (# AA)342
Molecular Weight39kDa
Protein InteractionsCXCL16;
  1. What is the species homology for "CXCR6 Antibody - N-terminal region (AVARP07030_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human".

  2. How long will it take to receive "CXCR6 Antibody - N-terminal region (AVARP07030_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "CXCR6 Antibody - N-terminal region (AVARP07030_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "CXCR6 Antibody - N-terminal region (AVARP07030_P050)"?

    This target may also be called "BONZO, CD186, CDw186, STRL33, TYMSTR" in publications.

  5. What is the shipping cost for "CXCR6 Antibody - N-terminal region (AVARP07030_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "CXCR6 Antibody - N-terminal region (AVARP07030_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "CXCR6 Antibody - N-terminal region (AVARP07030_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "39kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "CXCR6 Antibody - N-terminal region (AVARP07030_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "CXCR6"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "CXCR6"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "CXCR6"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "CXCR6"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "CXCR6"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "CXCR6"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:CXCR6 Antibody - N-terminal region (AVARP07030_P050)
Your Rating