CXCR6 Antibody - N-terminal region (AVARP07030_P050)

Catalog No: AVARP07030_P050

WB Suggested Anti-CXCR6 Antibody Titration: 0.2-1 ug/ml
Positive Control: Human brain

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CXCR6
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Human: 100%
• Peptide Sequence: Synthetic peptide located within the following region: AEHDYHEDYGFSSFNDSSQEEHQDFLQFSKVFLPCMYLVVFVCGLVGNSL
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-CXCR6 (AVARP07030_P050) antibody is Catalog # AAP30813 (Previous Catalog # AAPP01477)
• Reference: Hu,W., (2008) Cancer Sci. 99 (7), 1362-1369

Target Info

• Gene Symbol: CXCR6
• Gene Full Name: Chemokine (C-X-C motif) receptor 6
• Alias Symbols: BONZO, CD186, CDw186, STRL33, TYMSTR
• NCBI Gene Id: 10663
• Protein Name: C-X-C chemokine receptor type 6
• Description of Target: CXCR6 is a receptor for the C-X-C chemokine CXCL16. It is used as a coreceptor by SIVs and by strains of HIV-2 and m-tropic HIV-1.The CXCR6/AKT/mTOR pathway plays a central role in the development of prostate cancer. CXCR6 and CXCR3 act coordinately with respective ligands and are involved in the pathophysiology of Juvenile Idiopathic Arthritis-associated inflammatory processes. The CXCL16-CXCR6-system express in human schwannomas of different localization and in malignant peripheral nerve sheath tumors. The protein may play an important role in the retention of T cells within the lung.
• Uniprot ID: O00574
• Protein Accession #: NP_006555
• Nucleotide Accession #: NM_006564
• Protein Size (# AA): 342
• Molecular Weight: 39kDa
• Protein Interactions: CXCL16;