Size:100 ul
Special Price $229.00 Regular Price $289.00
In Stock
SKU
ARP73809_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP73809_P050-FITC Conjugated

ARP73809_P050-HRP Conjugated

ARP73809_P050-Biotin Conjugated

CXCR5 Antibody - N-terminal region (ARP73809_P050)

Catalog#: ARP73809_P050
Domestic: within 1-2 days delivery | International: 1-2 days
Click here to learn more about Aviva's By-Request Conjugation Service.
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Human
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Immunogen The immunogen is a synthetic peptide directed towards the N-terminal region of Human CXCR5
Purification Affinity Purified
Peptide Sequence Synthetic peptide located within the following region: LEDLFWELDRLDNYNDTSLVENHLCPATEGPLMASFKAVFVPVAYSLIFL
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-CXCR5 (ARP73809_P050) antibody is Catalog # AAP73809
Datasheets/Manuals Printable datasheet for anti-CXCR5 (ARP73809_P050) antibody
Gene Symbol CXCR5
Alias Symbols CXCR5, BLR1, MDR15,
NCBI Gene Id 643
Description of Target This gene encodes a multi-pass membrane protein that belongs to the CXC chemokine receptor family. It is expressed in mature B-cells and Burkitt's lymphoma. This cytokine receptor binds to B-lymphocyte chemoattractant (BLC), and is involved in B-cell migration into B-cell follicles of spleen and Peyer patches. Alternatively spliced transcript variants encoding different isoforms have been described for this gene.
Swissprot Id P32302
Protein Size (# AA) 372
Molecular Weight 40kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express CXCR5.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express CXCR5.
Protein Interactions UBC; NEDD8; CXCL13; CXCR5;
  1. What is the species homology for "CXCR5 Antibody - N-terminal region (ARP73809_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human".

  2. How long will it take to receive "CXCR5 Antibody - N-terminal region (ARP73809_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "CXCR5 Antibody - N-terminal region (ARP73809_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "CXCR5 Antibody - N-terminal region (ARP73809_P050)"?

    This target may also be called "CXCR5, BLR1, MDR15, " in publications.

  5. What is the shipping cost for "CXCR5 Antibody - N-terminal region (ARP73809_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "CXCR5 Antibody - N-terminal region (ARP73809_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "CXCR5 Antibody - N-terminal region (ARP73809_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "40kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "CXCR5 Antibody - N-terminal region (ARP73809_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "CXCR5"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "CXCR5"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "CXCR5"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "CXCR5"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "CXCR5"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "CXCR5"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:CXCR5 Antibody - N-terminal region (ARP73809_P050)
Your Rating
We found other products you might like!