Search Antibody, Protein, and ELISA Kit Solutions

CXCR5 Antibody - N-terminal region (ARP73809_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP73809_P050-FITC Conjugated

ARP73809_P050-HRP Conjugated

ARP73809_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
CXCR5
NCBI Gene Id:
643
Swissprot Id:
P32302
Alias Symbols:
CXCR5, BLR1, MDR15,
Description of Target:
This gene encodes a multi-pass membrane protein that belongs to the CXC chemokine receptor family. It is expressed in mature B-cells and Burkitt's lymphoma. This cytokine receptor binds to B-lymphocyte chemoattractant (BLC), and is involved in B-cell migration into B-cell follicles of spleen and Peyer patches. Alternatively spliced transcript variants encoding different isoforms have been described for this gene.
Protein Size (# AA):
372
Molecular Weight:
40kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express CXCR5.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express CXCR5.
Immunogen:
The immunogen is a synthetic peptide directed towards the N-terminal region of Human CXCR5
Predicted Species Reactivity:
Human
Tested Species Reactivity:
Human
Peptide Sequence:
Synthetic peptide located within the following region: LEDLFWELDRLDNYNDTSLVENHLCPATEGPLMASFKAVFVPVAYSLIFL
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
UBC; NEDD8; CXCL13; CXCR5;
Blocking Peptide:
For anti-CXCR5 (ARP73809_P050) antibody is Catalog # AAP73809
Datasheets/Manuals:
Printable datasheet for anti-CXCR5 (ARP73809_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...