Catalog No: OPCA05092
Price: $0.00
SKU
OPCA05092
Availability: Domestic: Antibody & Kits: 2 weeks | Proteins: 4-6 weeks | International: Antibody & Kits: 2 weeks | Proteins: 4-6 weeks
Contact Us:
- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
Shipping Info:
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
Datasheets/Manuals | Printable datasheet for CXCR4 Recombinant Protein (Human) (OPCA05092) (OPCA05092) |
---|
Predicted Species Reactivity | Homo sapiens|Human |
---|---|
Product Format | Liquid or Lyophilized powder |
Reconstitution and Storage | -20°C or -80°C |
Purification | Affinity purified using IMAC |
Purity | Greater than 90% as determined by SDS-PAGE. |
Peptide Sequence | PILYAFLGAKFKTSAQHALTSVSRGSSLKILSKGKRGGHSSVSTESESSS |
Protein Sequence | Partial of Isoform 2 (303-352aa): PILYAFLGAKFKTSAQHALTSVSRGSSLKILSKGKRGGHSSVSTESESSS |
Source | E.coli |
Protein Range | 303-352 aa |
Tag | N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged |
Reference | A proposed bovine neuropeptide Y (NPY) receptor cDNA clone, or its human homologue, confers neither NPY binding sites nor NPY responsiveness on transfected cells. Jazin E.E., Yoo H., Blomqvist A.G., Yee F., Weng G., Walker M.W., Salon J., Larhammar D., Wahlestedt C.R. Regul. Pept. 47:247-258(1993) |
Gene Symbol | CXCR4 |
---|---|
Gene Full Name | C-X-C motif chemokine receptor 4 |
Alias Symbols | CD184;CD184 antigen;chemokine (C-X-C motif) receptor 4;C-X-C chemokine receptor type 4;D2S201E;FB22;fusin;HM89;HSY3RR;LAP3;LAP-3;LCR1;LESTR;leukocyte-derived seven transmembrane domain receptor;lipopolysaccharide-associated protein 3;LPS-associated protein 3;neuropeptide Y receptor Y3;neuropeptide Y3 receptor;NPY3R;NPYR;NPYRL;NPYY3R;SDF-1 receptor;seven transmembrane helix receptor;seven-transmembrane-segment receptor, spleen;stromal cell-derived factor 1 receptor;WHIM;WHIMS;WHIMS1. |
NCBI Gene Id | 7852 |
Protein Name | C-X-C chemokine receptor type 4 |
Description of Target | Receptor for the C-X-C chemokine CXCL12/SDF-1 that transduces a signal by increasing intracellular calcium ion levels and enhancing MAPK1/MAPK3 activation. Acts as a receptor for extracellular ubiquitin; leading to enhanced intracellular calcium ions and reduced cellular cAMP levels. Involved in hematopoiesis and in cardiac ventricular septum formation. Also plays an essential role in vascularization of the gastrointestinal tract, probably by regulating vascular branching and/or remodeling processes in endothelial cells. Involved in cerebellar development. In the CNS, could mediate hippocampal-neuron survival. |
Uniprot ID | P61073 |
Protein Accession # | NP_001008540 |
Nucleotide Accession # | NM_001008540 |
Protein Size (# AA) | Recombinant |
Molecular Weight | 25.2 kDa |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
Write Your Own Review
We found other products you might like!