CXCR2 Recombinant Protein (Human) (OPCA04205)

Catalog No: OPCA04205

Product Info

• Predicted Species Reactivity: Homo sapiens|Human
• Product Format: Liquid or Lyophilized powder
• Additional Information: Species Specificity Detail: Homo sapiens (Human)
• Reconstitution and Storage: -20°C or -80°C
• Formulation: Tris-base, 50% glycerol
• Purity: Greater than 90% as determined by SDS-PAGE.
• Peptide Sequence: MEDFNMESDSFEDFWKGEDLSNYSYSSTLPPFLLDAAPCE
• Protein Sequence: MEDFNMESDSFEDFWKGEDLSNYSYSSTLPPFLLDAAPCE
• Storage Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: E.coli
• Protein Range: 1-40 aa
• Tag: N-terminal 6xHis-SUMO-tagged
• Reference: Cloning of complementary DNA encoding a functional human interleukin-8 receptor.Murphy P.M., Tiffany H.L.Science 253:1280-1283(1991)

Target Info

• Gene Symbol: CXCR2
• Gene Full Name: C-X-C motif chemokine receptor 2
• Alias Symbols: CD182;CDw128b;chemokine (CXC) receptor 2;CMKAR2;C-X-C chemokine receptor type 2;CXCR-2;CXC-R2;CXCR2 gene for IL8 receptor type B;GRO/MGSA receptor;high affinity interleukin-8 receptor B;IL-8 receptor type 2;IL-8R B;IL8R2;IL8RA;IL8RB;interleukin 8 receptor type 2;interleukin 8 receptor, beta;interleukin-8 receptor type B;WHIMS2.
• NCBI Gene Id: 3579
• Protein Name: C-X-C chemokine receptor type 2
• Description of Target: Receptor for interleukin-8 which is a powerful neutrophil chemotactic factor. Binding of IL-8 to the receptor causes activation of neutrophils. This response is mediated via a G-protein that activates a phosphatidylinositol-calcium second messenger system. Binds to IL-8 with high affinity. Also binds with high affinity to CXCL3, GRO/MGSA and NAP-2.
• Uniprot ID: P25025
• Protein Accession #: NP_001161770
• Nucleotide Accession #: NM_001168298
• Protein Size (# AA): Recombinant
• Molecular Weight: 20.6 kDa