CXCL9 Recombinant Protein (Rabbit) (OPCA03521)

Catalog No: OPCA03521

Product Info

• Predicted Species Reactivity: Oryctolagus cuniculus|Rabbit
• Product Format: Liquid or Lyophilized powder
• Host: Rabbit
• Reconstitution and Storage: -20°C or -80°C
• Formulation: 20 mM Tris-HCl based buffer, pH 8.0
• Purity: Greater than 90% as determined by SDS-PAGE.
• Peptide Sequence: SPIMRNGRCSCISSTQGKIHLQSLKDLKQFSPSPSCGKTEIIATKKDGTQICLNPDSTEVKELVEKWKKQSSPKKKQKKGKKQRKVKKSLKKSQRPHQKKTA
• Protein Sequence: SPIMRNGRCSCISSTQGKIHLQSLKDLKQFSPSPSCGKTEIIATKKDGTQICLNPDSTEVKELVEKWKKQSSPKKKQKKGKKQRKVKKSLKKSQRPHQKKTA
• Storage Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: E.coli
• Protein Range: 23-124 aa
• Tag: N-terminal 6xHis-SUMO-tagged

Target Info

• Reference: Genome Sequence of Oryctolagus cuniculus (European rabbit).The Genome Sequencing PlatformDi Palma F., Heiman D., Young S., Gnerre S., Johnson J., Lander E.S., Lindblad-Toh K.Submitted (AUG-2009)
• Gene Symbol: CXCL9
• NCBI Gene Id: 103350772
• Protein Name: C-X-C motif chemokine
• Uniprot ID: U3KNX2
• Protein Accession #: XP_008265949.1
  
• Nucleotide Accession #: XM_008267727.1
• Protein Size (# AA): Recombinant
• Molecular Weight: 27.5 kDa