Catalog No: OPCA03521
Price: $0.00
SKU
OPCA03521
Availability: Domestic: Antibody & Kits: 2 weeks | Proteins: 4-6 weeks | International: Antibody & Kits: 2 weeks | Proteins: 4-6 weeks
Contact Us:
- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
Shipping Info:
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
Datasheets/Manuals | Printable datasheet for CXCL9 Recombinant Protein (Rabbit) (OPCA03521) (OPCA03521) |
---|
Predicted Species Reactivity | Oryctolagus cuniculus|Rabbit |
---|---|
Product Format | Liquid or Lyophilized powder |
Host | Rabbit |
Reconstitution and Storage | -20°C or -80°C |
Formulation | 20 mM Tris-HCl based buffer, pH 8.0 |
Purity | Greater than 90% as determined by SDS-PAGE. |
Peptide Sequence | SPIMRNGRCSCISSTQGKIHLQSLKDLKQFSPSPSCGKTEIIATKKDGTQICLNPDSTEVKELVEKWKKQSSPKKKQKKGKKQRKVKKSLKKSQRPHQKKTA |
Protein Sequence | SPIMRNGRCSCISSTQGKIHLQSLKDLKQFSPSPSCGKTEIIATKKDGTQICLNPDSTEVKELVEKWKKQSSPKKKQKKGKKQRKVKKSLKKSQRPHQKKTA |
Storage Buffer | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Source | E.coli |
Protein Range | 23-124 aa |
Tag | N-terminal 6xHis-SUMO-tagged |
Reference | Genome Sequence of Oryctolagus cuniculus (European rabbit).The Genome Sequencing PlatformDi Palma F., Heiman D., Young S., Gnerre S., Johnson J., Lander E.S., Lindblad-Toh K.Submitted (AUG-2009) |
---|---|
Gene Symbol | CXCL9 |
NCBI Gene Id | 103350772 |
Protein Name | C-X-C motif chemokine |
Uniprot ID | U3KNX2 |
Protein Accession # | XP_008265949.1 |
Nucleotide Accession # | XM_008267727.1 |
Protein Size (# AA) | Recombinant |
Molecular Weight | 27.5 kDa |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
Write Your Own Review
We found other products you might like!