Catalog No: OPCA201613
Price: $0.00
SKU
OPCA201613
Availability: Domestic: within 4-8 weeks delivery International: 4-8 weeks
Contact Us:
- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
Shipping Info:
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
Protein on Demand™ CXCL8 Recombinant Protein (Nine-banded armadillo) (OPCA201613)
| Datasheets/Manuals | Printable datasheet for OPCA201613 |
|---|
| Predicted Species Reactivity | Nine-banded armadillo |
|---|---|
| Product Format | Liquid |
| Application | WB, ELISA |
| Reconstitution and Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Protein Sequence | AVLSRSGTELRCLCINTHSTYFHPRVIKELRVIESGPHCPNTEIMSVKLVNGAEVCLDPKQKWVQKVVELFLKR |
| Storage Buffer | Tris-based buffer,50% glycerol |
| Protein Range | 23-96 |
| Alias Symbols | IL8, IL-8 |
|---|---|
| NCBI Gene Id | 101441641 |
| Protein Name | interleukin-8 |
| Uniprot ID | Q102R3 |
| Protein Size (# AA) | 74 |
Write Your Own Review