Protein on Demand™ CXCL3 Recombinant Protein (Rat) (OPCA204247)

Datasheets/Manuals	Printable datasheet for OPCA204247

Product Info
Predicted Species Reactivity	Rat
Product Format	Liquid
Application	WB, ELISA
Reconstitution and Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Purity	Greater than 85% as determined by SDS-PAGE.
Protein Sequence	RELRCQCLKTLPRVDFENIQSLTVTPPGPHCTQTEVIATLKDGQEVCLNPQAPRLQKIIQKLLKSDKSS
Storage Buffer	Tris-based buffer,50% glycerol
Protein Range	33-101

Gene Full Name	chemokine (C-X-C motif) ligand 3
Alias Symbols	Cinc2, Cinc-2, Gm1960
NCBI Gene Id	171551
Protein Name	C-X-C motif chemokine 3
Description of Target	acts as a chemoattractant for neutrophils; involved in the inflammatory response [RGD, Feb 2006]
Uniprot ID	Q10746
Protein Accession #	NP_612531.1
Nucleotide Accession #	NM_138522.1
Protein Size (# AA)	69