Search Antibody, Protein, and ELISA Kit Solutions

CXCL3 Antibody - middle region (AVARP07037_T100)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

AVARP07037_T100-FITC Conjugated

AVARP07037_T100-HRP Conjugated

AVARP07037_T100-Biotin Conjugated

Gene Symbol:
Official Gene Full Name:
Chemokine (C-X-C motif) ligand 3
NCBI Gene Id:
Protein Name:
C-X-C motif chemokine 3
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-1376 from Santa Cruz Biotechnology.
Description of Target:
CXCL3 may play a role in inflammation and exert its effects on endothelial cells in an autocrine fashion.
Protein Size (# AA):
Molecular Weight:
Protein A purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express CXCL3.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express CXCL3.
The immunogen is a synthetic peptide directed towards the middle region of human CXCL3
Predicted Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Human: 100%
Complete computational species homology data:
Anti-CXCL3 (AVARP07037_T100)
Peptide Sequence:
Synthetic peptide located within the following region: QSVNVRSPGPHCAQTEVIATLKNGKKACLNPASPMVQKIIEKILNKGSTN
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-CXCL3 (AVARP07037_T100) antibody is Catalog # AAP30824 (Previous Catalog # AAPP01488)
Printable datasheet for anti-CXCL3 (AVARP07037_T100) antibody
Target Reference:
Tekamp-Olson, P., et al., (1990) J. Exp. Med. 172:911-919.

Cheng, C.-F. et al. Profiling motility signal-specific genes in primary human keratinocytes. J. Invest. Dermatol. 128, 1981-90 (2008). WB, Human 18323786

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...