Size:100 ul
$249.00
In Stock
SKU
AVARP07037_T100
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

AVARP07037_T100-FITC Conjugated

AVARP07037_T100-HRP Conjugated

AVARP07037_T100-Biotin Conjugated

CXCL3 Antibody - middle region (AVARP07037_T100)

Catalog#: AVARP07037_T100
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Predicted Species Reactivity Human
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-1376 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human CXCL3
Purification Protein A purified
Predicted Homology Based on Immunogen Sequence Human: 100%
Complete computational species homology data Anti-CXCL3 (AVARP07037_T100)
Peptide Sequence Synthetic peptide located within the following region: QSVNVRSPGPHCAQTEVIATLKNGKKACLNPASPMVQKIIEKILNKGSTN
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-CXCL3 (AVARP07037_T100) antibody is Catalog # AAP30824 (Previous Catalog # AAPP01488)
Datasheets/Manuals Printable datasheet for anti-CXCL3 (AVARP07037_T100) antibody
Target Reference Tekamp-Olson, P., et al., (1990) J. Exp. Med. 172:911-919.
Publications

Cheng, C.-F. et al. Profiling motility signal-specific genes in primary human keratinocytes. J. Invest. Dermatol. 128, 1981-90 (2008). WB, Human 18323786

Gene Symbol CXCL3
Official Gene Full Name Chemokine (C-X-C motif) ligand 3
Alias Symbols GRO3, GROg, MIP2B, SCYB3, MIP-2b, CINC-2b
NCBI Gene Id 2921
Protein Name C-X-C motif chemokine 3
Description of Target CXCL3 may play a role in inflammation and exert its effects on endothelial cells in an autocrine fashion.
Swissprot Id P19876
Protein Accession # NP_002081
Nucleotide Accession # NM_002090
Protein Size (# AA) 107
Molecular Weight 11kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express CXCL3.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express CXCL3.
Protein Interactions CXCR1; CXCR2;
  1. What is the species homology for "CXCL3 Antibody - middle region (AVARP07037_T100)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human".

  2. How long will it take to receive "CXCL3 Antibody - middle region (AVARP07037_T100)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "CXCL3 Antibody - middle region (AVARP07037_T100)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "CXCL3 Antibody - middle region (AVARP07037_T100)"?

    This target may also be called "GRO3, GROg, MIP2B, SCYB3, MIP-2b, CINC-2b" in publications.

  5. What is the shipping cost for "CXCL3 Antibody - middle region (AVARP07037_T100)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "CXCL3 Antibody - middle region (AVARP07037_T100)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "CXCL3 Antibody - middle region (AVARP07037_T100)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "11kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "CXCL3 Antibody - middle region (AVARP07037_T100)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "CXCL3"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "CXCL3"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "CXCL3"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "CXCL3"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "CXCL3"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "CXCL3"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:CXCL3 Antibody - middle region (AVARP07037_T100)
Your Rating
We found other products you might like!