Search Antibody, Protein, and ELISA Kit Solutions

CXCL3 Antibody - middle region (AVARP07037_T100)

100 ul
$249.00
In Stock
Request Bulk Order Quote

Conjugation Options

AVARP07037_T100-FITC Conjugated

AVARP07037_T100-HRP Conjugated

AVARP07037_T100-Biotin Conjugated

Predicted Species Reactivity:
Human
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
WB
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
CXCL3
Official Gene Full Name:
Chemokine (C-X-C motif) ligand 3
NCBI Gene Id:
2921
Protein Name:
C-X-C motif chemokine 3
Swissprot Id:
P19876
Protein Accession #:
NP_002081
Nucleotide Accession #:
NM_002090
Alias Symbols:
GRO3, GROg, MIP2B, SCYB3, MIP-2b, CINC-2b
Replacement Item:
This antibody may replace item sc-1376 from Santa Cruz Biotechnology.
Description of Target:
CXCL3 may play a role in inflammation and exert its effects on endothelial cells in an autocrine fashion.
Protein Size (# AA):
107
Molecular Weight:
11kDa
Purification:
Protein A purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express CXCL3.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express CXCL3.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human CXCL3
Predicted Homology Based on Immunogen Sequence:
Human: 100%
Complete computational species homology data:
Anti-CXCL3 (AVARP07037_T100)
Peptide Sequence:
Synthetic peptide located within the following region: QSVNVRSPGPHCAQTEVIATLKNGKKACLNPASPMVQKIIEKILNKGSTN
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
CXCR1; CXCR2;
Blocking Peptide:
For anti-CXCL3 (AVARP07037_T100) antibody is Catalog # AAP30824 (Previous Catalog # AAPP01488)
Datasheets/Manuals:
Printable datasheet for anti-CXCL3 (AVARP07037_T100) antibody
Target Reference:
Tekamp-Olson, P., et al., (1990) J. Exp. Med. 172:911-919.
Publications:

Cheng, C.-F. et al. Profiling motility signal-specific genes in primary human keratinocytes. J. Invest. Dermatol. 128, 1981-90 (2008). WB, Human 18323786

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...