Size:100 ul
$249.00
In stock
SKU
AVARP07037_T100
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

AVARP07037_T100-FITC Conjugated

AVARP07037_T100-HRP Conjugated

AVARP07037_T100-Biotin Conjugated

CXCL3 Antibody - middle region (AVARP07037_T100)

Catalog#: AVARP07037_T100
Domestic: within 1-2 days delivery International: 1-2 days
More Information
Predicted Species Reactivity Human
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-1376 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human CXCL3
Purification Protein A purified
Predicted Homology Based on Immunogen Sequence Human: 100%
Complete computational species homology data Anti-CXCL3 (AVARP07037_T100)
Peptide Sequence Synthetic peptide located within the following region: QSVNVRSPGPHCAQTEVIATLKNGKKACLNPASPMVQKIIEKILNKGSTN
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-CXCL3 (AVARP07037_T100) antibody is Catalog # AAP30824 (Previous Catalog # AAPP01488)
Datasheets/Manuals Printable datasheet for anti-CXCL3 (AVARP07037_T100) antibody
Target Reference Tekamp-Olson, P., et al., (1990) J. Exp. Med. 172:911-919.
Publications

Cheng, C.-F. et al. Profiling motility signal-specific genes in primary human keratinocytes. J. Invest. Dermatol. 128, 1981-90 (2008). WB, Human 18323786

Gene Symbol CXCL3
Official Gene Full Name Chemokine (C-X-C motif) ligand 3
Alias Symbols GRO3, GROg, MIP2B, SCYB3, MIP-2b, CINC-2b
NCBI Gene Id 2921
Protein Name C-X-C motif chemokine 3
Description of Target CXCL3 may play a role in inflammation and exert its effects on endothelial cells in an autocrine fashion.
Swissprot Id P19876
Protein Accession # NP_002081
Nucleotide Accession # NM_002090
Protein Size (# AA) 107
Molecular Weight 11kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express CXCL3.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express CXCL3.
Protein Interactions CXCR1; CXCR2;
Write Your Own Review
You're reviewing:CXCL3 Antibody - middle region (AVARP07037_T100)
Your Rating