Catalog No: OPCA17096
Price: $0.00
SKU
OPCA17096
Availability: Domestic: within 4-8 weeks delivery International: 4-8 weeks
Contact Us:
- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
Shipping Info:
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
Protein on Demand™ CXCL14 Recombinant Protein (Human) (OPCA17096)
Datasheets/Manuals | Printable datasheet for OPCA17096 |
---|
Predicted Species Reactivity | Human |
---|---|
Product Format | Liquid |
Application | WB, ELISA |
Reconstitution and Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Purity | Greater than 85% as determined by SDS-PAGE. |
Protein Sequence | SKCKCSRKGPKIRYSDVKKLEMKPKYPHCEEKMVIITTKSVSRYRGQEHCLHPKLQSTKRFIKWYNAWNEKRRVYEE |
Storage Buffer | Tris-based buffer,50% glycerol |
Protein Range | 35-111 |
Gene Full Name | C-X-C motif chemokine ligand 14 |
---|---|
Alias Symbols | KEC, KS1, BMAC, BRAK, NJAC, MIP2G, MIP-2g, SCYB14 |
NCBI Gene Id | 9547 |
Protein Name | C-X-C motif chemokine 14 |
Description of Target | This antimicrobial gene belongs to the cytokine gene family which encode secreted proteins involved in immunoregulatory and inflammatory processes. The protein encoded by this gene is structurally related to the CXC (Cys-X-Cys) subfamily of cytokines. Mem |
Uniprot ID | O95715 |
Protein Accession # | NP_004878.2 |
Nucleotide Accession # | NM_004887.4 |
Protein Size (# AA) | 77 |
Write Your Own Review