Search Antibody, Protein, and ELISA Kit Solutions

CXCL14 Antibody - middle region : FITC (AVARP07023_P050-FITC)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

AVARP07023_P050 Unconjugated

AVARP07023_P050-HRP Conjugated

AVARP07023_P050-Biotin Conjugated

Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Rat
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer.
FITC (FAM): Excitation 495 nm/ Emission 520 nm
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Gene Symbol:
Official Gene Full Name:
Chemokine (C-X-C motif) ligand 14
NCBI Gene Id:
Protein Name:
C-X-C motif chemokine 14
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-130979 from Santa Cruz Biotechnology.
Description of Target:
CXCL14 belongs to the cytokine family which encode secreted proteins involved in immunoregulatory and inflammatory processes. The protein encoded by this gene is structurally related to the CXC (Cys-X-Cys) subfamily of cytokines. Members of this subfamily are characterized by two cysteines separated by a single amino acid. This cytokine displays chemotactic activity for monocytes but not for lymphocytes, dendritic cells, neutrophils or macrophages. It has been implicated that this cytokine is involved in the homeostasis of monocyte-derived macrophages rather than in inflammation.
Protein Size (# AA):
Molecular Weight:
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express CXCL14.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express CXCL14.
The immunogen is a synthetic peptide directed towards the middle region of human CXCL14
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Rat: 100%
Complete computational species homology data:
Anti-CXCL14 (AVARP07023_P050)
Peptide Sequence:
Synthetic peptide located within the following region: PHCEEKMVIITTKSVSRYRGQEHCLHPKLQSTKRFIKWYNAWNEKRRVYE
0.5 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-CXCL14 (AVARP07023_P050-FITC) antibody is Catalog # AAP30802
Printable datasheet for anti-CXCL14 (AVARP07023_P050-FITC) antibody

Takahashi, M. et al. CXCL14 enhances insulin-dependent glucose uptake in adipocytes and is related to high-fat diet-induced obesity. Biochem. Biophys. Res. Commun. 364, 1037-42 (2007). WB, Bovine, Dog, Guinea pig, Horse, Pig, Rat 17971304

Lietz, R. et al. Codelivery of the chemokine CCL3 by an adenovirus-based vaccine improves protection from retrovirus infection. J. Virol. 86, 1706-16 (2012). WB, Bovine, Dog, Guinea pig, Horse, Pig, Rat 22090142

Perrone, C. E. et al. Genomic and metabolic responses to methionine-restricted and methionine-restricted, cysteine-supplemented diets in Fischer 344 rat inguinal adipose tissue, liver and quadriceps muscle. J. Nutrigenet. Nutrigenomics 5, 132-57 (2012). WB, Bovine, Dog, Guinea pig, Horse, Pig, Rat 23052097

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...