Size:100 ul
In Stock
Request Bulk
Order Quote
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email:
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

AVARP07023_P050 Unconjugated

AVARP07023_P050-FITC Conjugated

AVARP07023_P050-HRP Conjugated

CXCL14 Antibody - middle region : Biotin (AVARP07023_P050-Biotin)

Catalog#: AVARP07023_P050-Biotin
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Rat
Product Format Liquid. Purified antibody supplied in 1x PBS buffer.
Clonality Polyclonal
Host Rabbit
Conjugation Biotin
Application IHC, WB
Reconstitution and Storage All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Replacement Item This antibody may replace item sc-130979 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human CXCL14
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Rat: 100%
Complete computational species homology data Anti-CXCL14 (AVARP07023_P050)
Peptide Sequence Synthetic peptide located within the following region: PHCEEKMVIITTKSVSRYRGQEHCLHPKLQSTKRFIKWYNAWNEKRRVYE
Concentration 0.5 mg/ml
Blocking Peptide For anti-CXCL14 (AVARP07023_P050-Biotin) antibody is Catalog # AAP30802
Datasheets/Manuals Printable datasheet for anti-CXCL14 (AVARP07023_P050-Biotin) antibody

Takahashi, M. et al. CXCL14 enhances insulin-dependent glucose uptake in adipocytes and is related to high-fat diet-induced obesity. Biochem. Biophys. Res. Commun. 364, 1037-42 (2007). WB, Bovine, Dog, Guinea pig, Horse, Pig, Rat 17971304

Lietz, R. et al. Codelivery of the chemokine CCL3 by an adenovirus-based vaccine improves protection from retrovirus infection. J. Virol. 86, 1706-16 (2012). WB, Bovine, Dog, Guinea pig, Horse, Pig, Rat 22090142

Perrone, C. E. et al. Genomic and metabolic responses to methionine-restricted and methionine-restricted, cysteine-supplemented diets in Fischer 344 rat inguinal adipose tissue, liver and quadriceps muscle. J. Nutrigenet. Nutrigenomics 5, 132-57 (2012). WB, Bovine, Dog, Guinea pig, Horse, Pig, Rat 23052097

Gene Symbol CXCL14
Official Gene Full Name Chemokine (C-X-C motif) ligand 14
Alias Symbols BMAC, BRAK, KEC, KS1, MGC10687, MIP-2g, MIP2G, NJAC, SCYB14
NCBI Gene Id 9547
Protein Name C-X-C motif chemokine 14
Description of Target CXCL14 belongs to the cytokine family which encode secreted proteins involved in immunoregulatory and inflammatory processes. The protein encoded by this gene is structurally related to the CXC (Cys-X-Cys) subfamily of cytokines. Members of this subfamily are characterized by two cysteines separated by a single amino acid. This cytokine displays chemotactic activity for monocytes but not for lymphocytes, dendritic cells, neutrophils or macrophages. It has been implicated that this cytokine is involved in the homeostasis of monocyte-derived macrophages rather than in inflammation.
Swissprot Id O95715
Protein Accession # NP_004878
Nucleotide Accession # NM_004887
Protein Size (# AA) 111
Molecular Weight 9kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express CXCL14.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express CXCL14.
Protein Interactions TEX11; TRIM23; REL; APP;
  1. What is the species homology for "CXCL14 Antibody - middle region : Biotin (AVARP07023_P050-Biotin)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Cow, Dog, Guinea Pig, Horse, Rat".

  2. How long will it take to receive "CXCL14 Antibody - middle region : Biotin (AVARP07023_P050-Biotin)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "CXCL14 Antibody - middle region : Biotin (AVARP07023_P050-Biotin)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer.".
    Additional format options may be available. For more information please contact

  4. What are other names for "CXCL14 Antibody - middle region : Biotin (AVARP07023_P050-Biotin)"?

    This target may also be called "BMAC, BRAK, KEC, KS1, MGC10687, MIP-2g, MIP2G, NJAC, SCYB14" in publications.

  5. What is the shipping cost for "CXCL14 Antibody - middle region : Biotin (AVARP07023_P050-Biotin)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "CXCL14 Antibody - middle region : Biotin (AVARP07023_P050-Biotin)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "CXCL14 Antibody - middle region : Biotin (AVARP07023_P050-Biotin)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "9kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "CXCL14 Antibody - middle region : Biotin (AVARP07023_P050-Biotin)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "CXCL14"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "CXCL14"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "CXCL14"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "CXCL14"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "CXCL14"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "CXCL14"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:CXCL14 Antibody - middle region : Biotin (AVARP07023_P050-Biotin)
Your Rating
We found other products you might like!