Size:100 ul
$229.00
In stock
SKU
AVARP07023_T100
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

AVARP07023_T100-FITC Conjugated

AVARP07023_T100-HRP Conjugated

AVARP07023_T100-Biotin Conjugated

CXCL14 Antibody - middle region (AVARP07023_T100)

Catalog#: AVARP07023_T100
Domestic: within 1-2 days delivery International: 1-2 days
More Information
Tested Species ReactivityHuman
Predicted Species ReactivityCow, Dog, Guinea Pig, Horse, Rat
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement ItemThis antibody may replace item sc-130979 from Santa Cruz Biotechnology.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human CXCL14
PurificationProtein A purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Rat: 100%
Complete computational species homology dataAnti-CXCL14 (AVARP07023_T100)
Peptide SequenceSynthetic peptide located within the following region: HCEEKMVIITTKSVSRYRGQEHCLHPKLQSTKRFIKWYNAWNEKRRVYEE
ConcentrationBatch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking PeptideFor anti-CXCL14 (AVARP07023_T100) antibody is Catalog # AAP30802 (Previous Catalog # AAPP01465)
Datasheets/ManualsPrintable datasheet for anti-CXCL14 (AVARP07023_T100) antibody
Target ReferenceClark,H.F., et al., (2003) Genome Res. 13 (10), 2265-2270
Gene SymbolCXCL14
Official Gene Full NameChemokine (C-X-C motif) ligand 14
Alias SymbolsKEC, KS1, BMAC, BRAK, NJAC, MIP2G, MIP-2g, SCYB14
NCBI Gene Id9547
Protein NameC-X-C motif chemokine 14
Description of TargetCXCL14 belongs to the cytokine family which encode secreted proteins involved in immunoregulatory and inflammatory processes. The protein encoded by this gene is structurally related to the CXC (Cys-X-Cys) subfamily of cytokines. Members of this subfamily are characterized by two cysteines separated by a single amino acid. This cytokine displays chemotactic activity for monocytes but not for lymphocytes, dendritic cells, neutrophils or macrophages. It has been implicated that this cytokine is involved in the homeostasis of monocyte-derived macrophages rather than in inflammation.
Swissprot IdQ9NS21
Protein Accession #NP_004878
Nucleotide Accession #NM_004887
Protein Size (# AA)111
Molecular Weight13kDa
Tissue ToolFind tissues and cell lines supported by DNA array analysis to express CXCL14.
RNA SeqFind tissues and cell lines supported by RNA-seq analysis to express CXCL14.
Protein InteractionsTEX11; TRIM23; REL; APP;
Write Your Own Review
You're reviewing:CXCL14 Antibody - middle region (AVARP07023_T100)
Your Rating
Aviva Tips and Tricks
Aviva Blast Tool
Aviva Tissue Tool
Assay Development