Search Antibody, Protein, and ELISA Kit Solutions

CXCL14 Antibody - middle region (AVARP07023_T100)

100 ul
$229.00
In Stock
Request Bulk Order Quote

Conjugation Options

AVARP07023_T100-FITC Conjugated

AVARP07023_T100-HRP Conjugated

AVARP07023_T100-Biotin Conjugated

Tested Species Reactivity:
Human
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Rat
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
WB
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item:
This antibody may replace item sc-130979 from Santa Cruz Biotechnology.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human CXCL14
Purification:
Protein A purified
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Rat: 100%
Complete computational species homology data:
Anti-CXCL14 (AVARP07023_T100)
Peptide Sequence:
Synthetic peptide located within the following region: HCEEKMVIITTKSVSRYRGQEHCLHPKLQSTKRFIKWYNAWNEKRRVYEE
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-CXCL14 (AVARP07023_T100) antibody is Catalog # AAP30802 (Previous Catalog # AAPP01465)
Datasheets/Manuals:
Printable datasheet for anti-CXCL14 (AVARP07023_T100) antibody
Target Reference:
Clark,H.F., et al., (2003) Genome Res. 13 (10), 2265-2270
Gene Symbol:
CXCL14
Official Gene Full Name:
Chemokine (C-X-C motif) ligand 14
Alias Symbols:
KEC, KS1, BMAC, BRAK, NJAC, MIP2G, MIP-2g, SCYB14
NCBI Gene Id:
9547
Protein Name:
C-X-C motif chemokine 14
Description of Target:
CXCL14 belongs to the cytokine family which encode secreted proteins involved in immunoregulatory and inflammatory processes. The protein encoded by this gene is structurally related to the CXC (Cys-X-Cys) subfamily of cytokines. Members of this subfamily are characterized by two cysteines separated by a single amino acid. This cytokine displays chemotactic activity for monocytes but not for lymphocytes, dendritic cells, neutrophils or macrophages. It has been implicated that this cytokine is involved in the homeostasis of monocyte-derived macrophages rather than in inflammation.
Swissprot Id:
Q9NS21
Protein Accession #:
NP_004878
Nucleotide Accession #:
NM_004887
Protein Size (# AA):
111
Molecular Weight:
13kDa
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express CXCL14.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express CXCL14.
Protein Interactions:
TEX11; TRIM23; REL; APP;

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...