Size:100 ul
Special Price $229.00 Regular Price $289.00
In stock
SKU
AVARP07023_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

AVARP07023_P050-FITC Conjugated

AVARP07023_P050-HRP Conjugated

AVARP07023_P050-Biotin Conjugated

CXCL14 Antibody - middle region (AVARP07023_P050)

Catalog#: AVARP07023_P050
Domestic: within 1-2 days delivery International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Rat
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application IHC, WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-130979 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human CXCL14
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Rat: 100%
Complete computational species homology data Anti-CXCL14 (AVARP07023_P050)
Peptide Sequence Synthetic peptide located within the following region: PHCEEKMVIITTKSVSRYRGQEHCLHPKLQSTKRFIKWYNAWNEKRRVYE
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-CXCL14 (AVARP07023_P050) antibody is Catalog # AAP30802
Datasheets/Manuals Printable datasheet for anti-CXCL14 (AVARP07023_P050) antibody
Publications

Lietz, R. et al. Codelivery of the chemokine CCL3 by an adenovirus-based vaccine improves protection from retrovirus infection. J. Virol. 86, 1706-16 (2012). IHC, WB, Cow, Dog, Guinea Pig, Horse, Rat 22090142

Perrone, C. E. et al. Genomic and metabolic responses to methionine-restricted and methionine-restricted, cysteine-supplemented diets in Fischer 344 rat inguinal adipose tissue, liver and quadriceps muscle. J. Nutrigenet. Nutrigenomics 5, 132-57 (2012). IHC, WB, Cow, Dog, Guinea Pig, Horse, Rat 23052097

Takahashi, M. et al. CXCL14 enhances insulin-dependent glucose uptake in adipocytes and is related to high-fat diet-induced obesity. Biochem. Biophys. Res. Commun. 364, 1037-42 (2007). IHC, WB, Cow, Dog, Guinea Pig, Horse, Rat 17971304

Gene Symbol CXCL14
Official Gene Full Name Chemokine (C-X-C motif) ligand 14
Alias Symbols BMAC, BRAK, KEC, KS1, MGC10687, MIP-2g, MIP2G, NJAC, SCYB14
NCBI Gene Id 9547
Protein Name C-X-C motif chemokine 14
Description of Target CXCL14 belongs to the cytokine family which encode secreted proteins involved in immunoregulatory and inflammatory processes. The protein encoded by this gene is structurally related to the CXC (Cys-X-Cys) subfamily of cytokines. Members of this subfamily are characterized by two cysteines separated by a single amino acid. This cytokine displays chemotactic activity for monocytes but not for lymphocytes, dendritic cells, neutrophils or macrophages. It has been implicated that this cytokine is involved in the homeostasis of monocyte-derived macrophages rather than in inflammation.
Swissprot Id O95715
Protein Accession # NP_004878
Nucleotide Accession # NM_004887
Protein Size (# AA) 111
Molecular Weight 9kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express CXCL14.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express CXCL14.
Protein Interactions TEX11; TRIM23; REL; APP;
Write Your Own Review
You're reviewing:CXCL14 Antibody - middle region (AVARP07023_P050)
Your Rating