- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
Datasheets/Manuals | Printable datasheet for CXCL12 Antibody (OAAL00300) |
---|
Predicted Species Reactivity | Human, Mouse |
---|---|
Product Format | Liquid |
Clonality | Monoclonal |
Clone | 1B2 |
Isotype | IgG2b Kappa |
Host | Mouse |
Application | Enzyme-linked immunosorbent assay |
Reconstitution and Storage | Store at -20C or lower. Aliquot to avoid repeated freezing and thawing. |
Immunogen | CXCL12 (AAH39893.1, 1 a.a. ~ 89 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Peptide Sequence | MNAKVVVVLVLVLTALCLSDGKPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNK |
Formulation | In 1x PBS, pH 7.4 |
Gene Symbol | CXCL12 |
---|---|
Gene Full Name | C-X-C motif chemokine ligand 12 |
Alias Symbols | chemokine (C-X-C motif) ligand 12;intercrine reduced in hepatomas;IRH;PBSF;pre-B cell growth-stimulating factor;SCYB12;SDF1;stromal cell-derived factor 1;TLSF;TPAR1. |
NCBI Gene Id | 6387 |
Protein Name | Chemokine (C-X-C motif) ligand 12 (stromal cell-derived factor 1) [Homo sapiens]|Homo sapiens chemokine (C-X-C motif) ligand 12 (stromal cell-derived factor 1), mRNA (cDNA clone MGC:47612 IMAGE:5729604), complete cds |
Description of Target | For background information on chemokines, see CXCL1 (MIM 155730). Stromal cell-derived factors 1-alpha and 1-beta are small cytokines that belong to the intercrine family, members of which activate leukocytes and are often induced by proinflammatory stimuli such as lipopolysaccharide, TNF (see MIM 191160), or IL1 (see MIM 147760). The intercrines are characterized by the presence of 4 conserved cysteines which form 2 disulfide bonds. They can be classified into 2 subfamilies. In the CC subfamily, which includes beta chemokine, the cysteine residues are adjacent to each other. In the CXC subfamily, which includes alpha chemokine, they are separated by an intervening amino acid. The SDF1 proteins belong to the latter group.[supplied by OMIM |
Protein Accession # | https://www.ncbi.nlm.nih.gov/protein/AAH39893.1 |
Nucleotide Accession # | https://www.ncbi.nlm.nih.gov/nuccore/BC039893 |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
-
What is the species homology for "CXCL12 Antibody (OAAL00300)"?
The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human, Mouse".
-
How long will it take to receive "CXCL12 Antibody (OAAL00300)"?
This item is available "Domestic: within 2-3 week delivery | International: 2-3 weeks".
-
What buffer format is "CXCL12 Antibody (OAAL00300)" provided in?
This item is provided in "Liquid".
Additional format options may be available. For more information please contact info@avivasysbio.com. -
What are other names for "CXCL12 Antibody (OAAL00300)"?
This target may also be called "chemokine (C-X-C motif) ligand 12;intercrine reduced in hepatomas;IRH;PBSF;pre-B cell growth-stimulating factor;SCYB12;SDF1;stromal cell-derived factor 1;TLSF;TPAR1." in publications.
-
What is the shipping cost for "CXCL12 Antibody (OAAL00300)"?
The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.
-
What is the guarantee for "CXCL12 Antibody (OAAL00300)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
-
Can I get bulk pricing for "CXCL12 Antibody (OAAL00300)"?
You can get bulk pricing for this item by going here.
-
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "".
Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics. -
What protocols are available for "CXCL12 Antibody (OAAL00300)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
-
What are positive controls for "CXCL12"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What are negative controls for "CXCL12"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What other proteins interact with "CXCL12"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
-
What biological processes are associated with "CXCL12"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
-
What cellular components are associated with "CXCL12"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
-
What protein functions are associated with "CXCL12"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.