- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
CXCL1 Antibody - middle region : Biotin (AVARP07032_P050-Biotin)
Datasheets/Manuals | Printable datasheet for anti-CXCL1 (AVARP07032_P050-Biotin) antibody |
---|
Predicted Species Reactivity | Human, Cow, Pig, Rabbit |
---|---|
Product Format | Liquid. Purified antibody supplied in 1x PBS buffer. |
Clonality | Polyclonal |
Host | Rabbit |
Conjugation | Biotin |
Application | WB |
Reconstitution and Storage | All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human CXCL1 |
Predicted Homology Based on Immunogen Sequence | Cow: 90%; Human: 100%; Pig: 85%; Rabbit: 90% |
Peptide Sequence | Synthetic peptide located within the following region: QSVNVKSPGPHCAQTEVIATLKNGRKACLNPASPIVKKIIEKMLNSDKSN |
Concentration | 0.5 mg/ml |
Blocking Peptide | For anti-CXCL1 (AVARP07032_P050-Biotin) antibody is Catalog # AAP30816 (Previous Catalog # AAPY04303) |
Reference | Omari,K.M., et al., (2006) Glia 53 (1), 24-31 |
Gene Symbol | CXCL1 |
---|---|
Gene Full Name | Chemokine (C-X-C motif) ligand 1 (melanoma growth stimulating activity, alpha) |
Alias Symbols | FSP, GRO1, GROa, MGSA, NAP-3, SCYB1, MGSA-a |
NCBI Gene Id | 2919 |
Protein Name | Growth-regulated alpha protein |
Description of Target | Chemokines are a group of small (approximately 8 to 14 kD), mostly basic, structurally related molecules that regulate cell trafficking of various types of leukocytes through interactions with a subset of 7-transmembrane, G protein-coupled receptors. Chemokines also play fundamental roles in the development, homeostasis, and function of the immune system, and they have effects on cells of the central nervous system as well as on endothelial cells involved in angiogenesis or angiostasis. Chemokines are divided into 2 major subfamilies, CXC and CC, based on the arrangement of the first 2 of the 4 conserved cysteine residues; the 2 cysteines are separated by a single amino acid in CXC chemokines and are adjacent in CC chemokines. CXC chemokines are further subdivided into ELR and non-ELR types based on the presence or absence of a glu-leu-arg sequence adjacent and N terminal to the CXC motif.Chemokines are a group of small (approximately 8 to 14 kD), mostly basic, structurally related molecules that regulate cell trafficking of various types of leukocytes through interactions with a subset of 7-transmembrane, G protein-coupled receptors. Chemokines also play fundamental roles in the development, homeostasis, and function of the immune system, and they have effects on cells of the central nervous system as well as on endothelial cells involved in angiogenesis or angiostasis. Chemokines are divided into 2 major subfamilies, CXC and CC, based on the arrangement of the first 2 of the 4 conserved cysteine residues; the 2 cysteines are separated by a single amino acid in CXC chemokines and are adjacent in CC chemokines. CXC chemokines are further subdivided into ELR and non-ELR types based on the presence or absence of a glu-leu-arg sequence adjacent and N terminal to the CXC motif.[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. |
Uniprot ID | P09341 |
Protein Accession # | NP_001502 |
Nucleotide Accession # | NM_001511 |
Protein Size (# AA) | 107 |
Molecular Weight | 8kDa |
Protein Interactions | HIPK2; CXCL1; CXCR1; CXCR2; MMP9; ACKR1; |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
-
What is the species homology for "CXCL1 Antibody - middle region : Biotin (AVARP07032_P050-Biotin)"?
The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human, Cow, Pig, Rabbit".
-
How long will it take to receive "CXCL1 Antibody - middle region : Biotin (AVARP07032_P050-Biotin)"?
This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".
-
What buffer format is "CXCL1 Antibody - middle region : Biotin (AVARP07032_P050-Biotin)" provided in?
This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer.".
Additional format options may be available. For more information please contact info@avivasysbio.com. -
What are other names for "CXCL1 Antibody - middle region : Biotin (AVARP07032_P050-Biotin)"?
This target may also be called "FSP, GRO1, GROa, MGSA, NAP-3, SCYB1, MGSA-a" in publications.
-
What is the shipping cost for "CXCL1 Antibody - middle region : Biotin (AVARP07032_P050-Biotin)"?
The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.
-
What is the guarantee for "CXCL1 Antibody - middle region : Biotin (AVARP07032_P050-Biotin)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
-
Can I get bulk pricing for "CXCL1 Antibody - middle region : Biotin (AVARP07032_P050-Biotin)"?
You can get bulk pricing for this item by going here.
-
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "8kDa".
Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics. -
What protocols are available for "CXCL1 Antibody - middle region : Biotin (AVARP07032_P050-Biotin)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
-
What are positive controls for "CXCL1"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What are negative controls for "CXCL1"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What other proteins interact with "CXCL1"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
-
What biological processes are associated with "CXCL1"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
-
What cellular components are associated with "CXCL1"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
-
What protein functions are associated with "CXCL1"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.