CXCL1 Antibody - middle region (AVARP07032_P050)

Catalog No: AVARP07032_P050

WB Suggested Anti-CXCL1 Antibody Titration: 0.0758ug/ml
Positive Control: Human Small Intestine

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Cow, Pig, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CXCL1
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 90%; Human: 100%; Pig: 85%; Rabbit: 90%
• Peptide Sequence: Synthetic peptide located within the following region: QSVNVKSPGPHCAQTEVIATLKNGRKACLNPASPIVKKIIEKMLNSDKSN
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-CXCL1 (AVARP07032_P050) antibody is Catalog # AAP30816 (Previous Catalog # AAPY04303)
• Reference: Omari,K.M., et al., (2006) Glia 53 (1), 24-31

Target Info

• Gene Symbol: CXCL1
• Gene Full Name: Chemokine (C-X-C motif) ligand 1 (melanoma growth stimulating activity, alpha)
• Alias Symbols: FSP, GRO1, GROa, MGSA, NAP-3, SCYB1, MGSA-a
• NCBI Gene Id: 2919
• Protein Name: Growth-regulated alpha protein
• Description of Target: Chemokines are a group of small (approximately 8 to 14 kD), mostly basic, structurally related molecules that regulate cell trafficking of various types of leukocytes through interactions with a subset of 7-transmembrane, G protein-coupled receptors. Chemokines also play fundamental roles in the development, homeostasis, and function of the immune system, and they have effects on cells of the central nervous system as well as on endothelial cells involved in angiogenesis or angiostasis. Chemokines are divided into 2 major subfamilies, CXC and CC, based on the arrangement of the first 2 of the 4 conserved cysteine residues; the 2 cysteines are separated by a single amino acid in CXC chemokines and are adjacent in CC chemokines. CXC chemokines are further subdivided into ELR and non-ELR types based on the presence or absence of a glu-leu-arg sequence adjacent and N terminal to the CXC motif.Chemokines are a group of small (approximately 8 to 14 kD), mostly basic, structurally related molecules that regulate cell trafficking of various types of leukocytes through interactions with a subset of 7-transmembrane, G protein-coupled receptors. Chemokines also play fundamental roles in the development, homeostasis, and function of the immune system, and they have effects on cells of the central nervous system as well as on endothelial cells involved in angiogenesis or angiostasis. Chemokines are divided into 2 major subfamilies, CXC and CC, based on the arrangement of the first 2 of the 4 conserved cysteine residues; the 2 cysteines are separated by a single amino acid in CXC chemokines and are adjacent in CC chemokines. CXC chemokines are further subdivided into ELR and non-ELR types based on the presence or absence of a glu-leu-arg sequence adjacent and N terminal to the CXC motif.[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Uniprot ID: P09341
• Protein Accession #: NP_001502
• Nucleotide Accession #: NM_001511
• Protein Size (# AA): 107
• Molecular Weight: 8kDa
• Protein Interactions: HIPK2; CXCL1; CXCR1; CXCR2; MMP9; ACKR1;