Catalog No: ARP91071_P050
Price: $0.00
SKU
ARP91071_P050
Availability: Domestic: within 24 hours delivery | International: 3-5 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-CXADR (ARP91071_P050) antibody
Product Info
Predicted Species ReactivityMouse
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of mouse CXADR
PurificationAffinity purified
Peptide SequenceSynthetic peptide located within the following region: RSYIGSNHSSLGSMSPSNMEGYSKTQYNQVPSEDFERAPQSPTLAPAKVA
Concentration0.5 mg/ml
Blocking PeptideFor anti-CXADR (ARP91071_P050) antibody is Catalog # AAP91071
Gene SymbolCXADR
Gene Full Namecoxsackie virus and adenovirus receptor
Alias SymbolsC, MC, CAR, MCV, MCAR, MCVADR, AU016810, AW553441, 2610206D03Rik
NCBI Gene Id13052
Protein Namecoxsackievirus and adenovirus receptor homolog
Description of TargetThis gene encodes a protein that is part of the Cortical Thymocyte marker in Xenopus (CTX) subfamily within the immunoglobulin superfamily. Members of this subfamily, predominantly expressed on the surface of endothelial and epithelial cells, help establish cell polarity and provide a barrier function, regulating migration of immune cells. This protein, first identified as the receptor for adenovirus subgroup C and coxsakieviruses group B, is developmentally regulated and plays an important role in cardiac development. Alternative splicing results in multiple transcript variants that encode different protein isoforms.
Uniprot IDP97792-2
Protein Accession #NP_001020363.1
Nucleotide Accession #NM_001025192.3
Protein Size (# AA)352
Molecular Weight38 kDa
  1. What is the species homology for "CXADR Antibody - middle region (ARP91071_P050)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Mouse".

  2. How long will it take to receive "CXADR Antibody - middle region (ARP91071_P050)"?

    This item is available "Domestic: within 24 hours delivery | International: 3-5 days".

  3. What buffer format is "CXADR Antibody - middle region (ARP91071_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "CXADR Antibody - middle region (ARP91071_P050)"?

    This target may also be called "C, MC, CAR, MCV, MCAR, MCVADR, AU016810, AW553441, 2610206D03Rik" in publications.

  5. What is the shipping cost for "CXADR Antibody - middle region (ARP91071_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "CXADR Antibody - middle region (ARP91071_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "CXADR Antibody - middle region (ARP91071_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "38 kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "CXADR Antibody - middle region (ARP91071_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "CXADR"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "CXADR"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "CXADR"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "CXADR"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "CXADR"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "CXADR"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:CXADR Antibody - middle region (ARP91071_P050)
Your Rating