CX3CR1 Antibody - C-terminal region : HRP (ARP73808_P050-HRP)

Catalog No: ARP73808_P050-HRP

Size:100ul

Product Info

• Predicted Species Reactivity: Human
• Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
• Clonality: Polyclonal
• Host: Rabbit
• Conjugation: HRP: Horseradish Peroxidase
• Application: WB
• Reconstitution and Storage: All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human CX3CR1
• Purification: Affinity Purified
• Peptide Sequence: Synthetic peptide located within the following region: EKFRRYLYHLYGKCLAVLCGRSVHVDFSSSESQRSRHGSVLSSNFTYHTS
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-CX3CR1 (ARP73808_P050-HRP) antibody is Catalog # AAP73808

Target Info

• Gene Symbol: CX3CR1
• Alias Symbols: V28, CCRL1, GPR13, CMKDR1, GPRV28, CMKBRL1
• NCBI Gene Id: 1524
• Description of Target: Fractalkine is a transmembrane protein and chemokine involved in the adhesion and migration of leukocytes. The protein encoded by this gene is a receptor for fractalkine. The encoded protein also is a coreceptor for HIV-1, and some variations in this gene lead to increased susceptibility to HIV-1 infection and rapid progression to AIDS. Four transcript variants encoding two different isoforms have been found for this gene.
• Uniprot ID: P49238
• Protein Accession #: NP_001328
• Protein Size (# AA): 355
• Molecular Weight: 39kDa
• Protein Interactions: CX3CL1;