Aviva Systems Biology office will be closed for Memorial Day - May 27, 2019.
Please go here for more info.

Search Antibody, Protein, and ELISA Kit Solutions

CX3CR1 Antibody - C-terminal region : FITC (ARP73808_P050-FITC)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP73808_P050 Unconjugated

ARP73808_P050-HRP Conjugated

ARP73808_P050-Biotin Conjugated

Gene Symbol:
CX3CR1
NCBI Gene Id:
1524
Swissprot Id:
P49238
Protein Accession #:
NP_001328
Alias Symbols:
CX3CR1, CMKBRL1, GPR13,
Replacement Item:
This antibody may replace item sc-20432 from Santa Cruz Biotechnology.
Description of Target:
Fractalkine is a transmembrane protein and chemokine involved in the adhesion and migration of leukocytes. The protein encoded by this gene is a receptor for fractalkine. The encoded protein also is a coreceptor for HIV-1, and some variations in this gene lead to increased susceptibility to HIV-1 infection and rapid progression to AIDS. Four transcript variants encoding two different isoforms have been found for this gene.
Protein Size (# AA):
355
Molecular Weight:
39kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express CX3CR1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express CX3CR1.
Immunogen:
The immunogen is a synthetic peptide directed towards the C-terminal region of Human CX3CR1
Predicted Species Reactivity:
Human
Peptide Sequence:
Synthetic peptide located within the following region: EKFRRYLYHLYGKCLAVLCGRSVHVDFSSSESQRSRHGSVLSSNFTYHTS
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer.
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Concentration:
1 mg/ml
Protein Interactions:
CX3CL1;
Blocking Peptide:
For anti-CX3CR1 (ARP73808_P050-FITC) antibody is Catalog # AAP73808
Datasheets/Manuals:
Printable datasheet for anti-CX3CR1 (ARP73808_P050-FITC) antibody
Conjugation:
FITC (FAM): Excitation 495 nm/ Emission 520 nm

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...