Search Antibody, Protein, and ELISA Kit Solutions

CUX1 Antibody - middle region (ARP97372_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Gene Symbol:
CUX1
Official Gene Full Name:
cut-like homeobox 1
NCBI Gene Id:
13047
Protein Name:
protein CASP
Swissprot Id:
P53564-5
Protein Accession #:
NP_001278162.1
Nucleotide Accession #:
NM_001291233.1
Alias Symbols:
CDP, Cux, Cutl1, Cux-1
Description of Target:
Probably has a broad role in mammalian development as a repressor of developmentally regulated gene expression. May act by preventing binding of positively-activing CCAAT factors to promoters. Component of nf-munr repressor; binds to the matrix attachment regions (MARs) (5' and 3') of the immunoglobulin heavy chain enhancer. Represses T-cell receptor (TCR) beta enhancer function by binding to MARbeta, an ATC-rich DNA sequence located upstream of the TCR beta enhancer. Binds to the TH enhancer; may require the basic helix-loop-helix protein TCF4 as a coactivator.
Protein Size (# AA):
460
Molecular Weight:
50 kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express CUX1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express CUX1.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of mouse CUX1
Predicted Species Reactivity:
Mouse
Tested Species Reactivity:
Mouse
Peptide Sequence:
Synthetic peptide located within the following region: DPNNVEKLMDMKRMEKKAYMKRRHSSVSDSQPCEPPSVGIDYSQGASPQP
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-CUX1 (ARP97372_P050) antibody is Catalog # AAP97372
Datasheets/Manuals:
Printable datasheet for anti-CUX1 (ARP97372_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...