CUGBP2 Antibody - N-terminal region (ARP40323_T100)

Catalog No: ARP40323_T100

Host: Rabbit
Target Name: CUGBP2
Sample Tissue: Human 293T
Antibody Dilution: 1.0ug/ml

Rabbit Anti-CUGBP2 Antibody
Catalog Number: ARP40323
Paraffin Embedded Tissue: Human Heart
Cellular Data: Myocardial cells
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X

Rabbit Anti-CELF2 Antibody
Catalog Number: ARP40323
Paraffin Embedded Tissue: Human alveolar cell
Cellular Data: Epithelial cells of renal tubule
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: IHC, WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CUGBP2
• Purification: Protein A purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
• Peptide Sequence: Synthetic peptide located within the following region: VYQINVLRDRSQNPPQSKGCCFVTFYTRKAALEAQNALHNIKTLPGMHHP
• Concentration: 1.0 mg/ml
• Blocking Peptide: For anti-CELF2 (ARP40323_T100) antibody is Catalog # AAP40323 (Previous Catalog # AAPP10360)
• Sample Type Confirmation:

  CELF2 is strongly supported by BioGPS gene expression data to be expressed in Jurkat

• Reference: Han,J. (2005) (er) Nucleic Acids Res. 33 (9), 2769-2780

Target Info

• Gene Symbol: CELF2
• Gene Full Name: CUGBP, Elav-like family member 2
• Alias Symbols: ETR3, ETR-3, NAPOR, CELF-2, CUGBP2, BRUNOL3, CUG-BP2
• NCBI Gene Id: 10659
• Protein Name: CUGBP Elav-like family member 2
• Description of Target: Members of the CELF/BRUNOL protein family contain two N-terminal RNA recognition motif (RRM) domains, one C-terminal RRM domain, and a divergent segment of 160-230 aa between the second and third RRM domains. Members of this protein family regulate pre-mRNA alternative splicing and may also be involved in mRNA editing, and translation.Members of the CELF/BRUNOL protein family contain two N-terminal RNA recognition motif (RRM) domains, one C-terminal RRM domain, and a divergent segment of 160-230 aa between the second and third RRM domains. Members of this protein family regulate pre-mRNA alternative splicing and may also be involved in mRNA editing, and translation. Alternative splicing results in multiple transcript variants encoding different isoforms.
• Uniprot ID: Q96RQ6
• Protein Accession #: NP_006552
• Nucleotide Accession #: NM_006561
• Protein Size (# AA): 509
• Molecular Weight: 56kDa
• Protein Interactions: PTGS2; ELAVL1; UBC; FN1; APP; PCBP1; A1CF; APOBEC1; Apob;