Search Antibody, Protein, and ELISA Kit Solutions

CTTN Antibody - N-terminal region (ARP52067_P050)

100 ul

Regular Price: $289.00

Special Price: $229.00

In Stock
Request Bulk Order Quote

Conjugation Options

ARP52067_P050-FITC Conjugated

ARP52067_P050-HRP Conjugated

ARP52067_P050-Biotin Conjugated

Tested Species Reactivity:
Human
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
WB, IHC
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item:
This antibody may replace item sc-11408 from Santa Cruz Biotechnology.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human CTTN
Purification:
Affinity Purified
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Complete computational species homology data:
Anti-CTTN (ARP52067_P050)
Peptide Sequence:
Synthetic peptide located within the following region: KHCSQVDSVRGFGGKFGVQMDRVDQSAVGFEYQGKTEKHASQKDYSSGFG
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-CTTN (ARP52067_P050) antibody is Catalog # AAP52067 (Previous Catalog # AAPP30292)
Datasheets/Manuals:
Printable datasheet for anti-CTTN (ARP52067_P050) antibody
Target Reference:
Ma,S.F., (er) Genet. Epidemiol. (2008) In press
Gene Symbol:
CTTN
Official Gene Full Name:
Cortactin
Alias Symbols:
EMS1, FLJ34459
NCBI Gene Id:
2017
Protein Name:
Src substrate cortactin
Description of Target:
CTTN is overexpressed in breast cancer and squamous cell carcinomas of the head and neck. CTTN is localized in the cytoplasm and in areas of the cell-substratum contacts. It has two roles: (1) regulating the interactions between components of adherens-type junctions and (2) organizing the cytoskeleton and cell adhesion structures of epithelia and carcinoma cells. During apoptosis, CTTN is degraded in a caspase-dependent manner. The aberrant regulation of t CTTN contributes to tumor cell invasion and metastasis.This gene is overexpressed in breast cancer and squamous cell carcinomas of the head and neck. The encoded protein is localized in the cytoplasm and in areas of the cell-substratum contacts. This gene has two roles: (1) regulating the interactions between components of adherens-type junctions and (2) organizing the cytoskeleton and cell adhesion structures of epithelia and carcinoma cells. During apoptosis, the encoded protein is degraded in a caspase-dependent manner. The aberrant regulation of this gene contributes to tumor cell invasion and metastasis. Two splice variants that encode different isoforms have been identified for this gene.
Swissprot Id:
Q8N707
Protein Accession #:
NP_005222
Nucleotide Accession #:
NM_005231
Protein Size (# AA):
550
Molecular Weight:
61kDa
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express CTTN.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express CTTN.
Protein Interactions:
SPRR2A; CDC37; CTTN; UBC; NEDD8; RPA3; RPA2; RPA1; VTA1; GSPT2; ATG7; UGDH; ME1; IDE; GSPT1; GARS; CTNNA1; ATP6V1C1; APEH; STAT1; SSB; SNX2; SNX1; SHMT2; SHMT1; SARS; RDX; ACTR2; NPM1; LMNA; ACTG1; ACTR3; PAN2; ATF2; DNM2; NCF1; Mbp; ASAP1; CORO1B; SDHAF2

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...