Catalog No: ARP52067_P050
Price: $0.00
SKU
ARP52067_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-CTTN (ARP52067_P050) antibody
Product Info
ReferenceMa,S.F., (er) Genet. Epidemiol. (2008) In press
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB, IHC
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human CTTN
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Peptide SequenceSynthetic peptide located within the following region: KHCSQVDSVRGFGGKFGVQMDRVDQSAVGFEYQGKTEKHASQKDYSSGFG
Concentration0.5 mg/ml
Blocking PeptideFor anti-CTTN (ARP52067_P050) antibody is Catalog # AAP52067 (Previous Catalog # AAPP30292)
Gene SymbolCTTN
Gene Full NameCortactin
Alias SymbolsEMS1
NCBI Gene Id2017
Protein NameSrc substrate cortactin
Description of TargetCTTN is overexpressed in breast cancer and squamous cell carcinomas of the head and neck. CTTN is localized in the cytoplasm and in areas of the cell-substratum contacts. It has two roles: (1) regulating the interactions between components of adherens-type junctions and (2) organizing the cytoskeleton and cell adhesion structures of epithelia and carcinoma cells. During apoptosis, CTTN is degraded in a caspase-dependent manner. The aberrant regulation of t CTTN contributes to tumor cell invasion and metastasis.This gene is overexpressed in breast cancer and squamous cell carcinomas of the head and neck. The encoded protein is localized in the cytoplasm and in areas of the cell-substratum contacts. This gene has two roles: (1) regulating the interactions between components of adherens-type junctions and (2) organizing the cytoskeleton and cell adhesion structures of epithelia and carcinoma cells. During apoptosis, the encoded protein is degraded in a caspase-dependent manner. The aberrant regulation of this gene contributes to tumor cell invasion and metastasis. Two splice variants that encode different isoforms have been identified for this gene.
Uniprot IDQ8N707
Protein Accession #NP_005222
Nucleotide Accession #NM_005231
Protein Size (# AA)550
Molecular Weight61kDa
Protein InteractionsSPRR2A; CDC37; CTTN; UBC; NEDD8; RPA3; RPA2; RPA1; VTA1; GSPT2; ATG7; UGDH; ME1; IDE; GSPT1; GARS; CTNNA1; ATP6V1C1; APEH; STAT1; SSB; SNX2; SNX1; SHMT2; SHMT1; SARS; RDX; ACTR2; NPM1; LMNA; ACTG1; ACTR3; PAN2; ATF2; DNM2; NCF1; Mbp; ASAP1; CORO1B; SDHAF2
  1. What is the species homology for "CTTN Antibody - N-terminal region (ARP52067_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish".

  2. How long will it take to receive "CTTN Antibody - N-terminal region (ARP52067_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "CTTN Antibody - N-terminal region (ARP52067_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "CTTN Antibody - N-terminal region (ARP52067_P050)"?

    This target may also be called "EMS1" in publications.

  5. What is the shipping cost for "CTTN Antibody - N-terminal region (ARP52067_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "CTTN Antibody - N-terminal region (ARP52067_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "CTTN Antibody - N-terminal region (ARP52067_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "61kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "CTTN Antibody - N-terminal region (ARP52067_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "CTTN"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "CTTN"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "CTTN"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "CTTN"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "CTTN"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "CTTN"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:CTTN Antibody - N-terminal region (ARP52067_P050)
Your Rating
We found other products you might like!