Search Antibody, Protein, and ELISA Kit Solutions

CTTN Antibody - middle region (ARP87102_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Gene Symbol:
CTTN
Official Gene Full Name:
cortactin
NCBI Gene Id:
2017
Protein Name:
src substrate cortactin
Swissprot Id:
Q14247-2
Protein Accession #:
NP_001171669.1
Nucleotide Accession #:
NM_001184740.1
Alias Symbols:
EMS1
Description of Target:
This gene is overexpressed in breast cancer and squamous cell carcinomas of the head and neck. The encoded protein is localized in the cytoplasm and in areas of the cell-substratum contacts. This gene has two roles: (1) regulating the interactions between components of adherens-type junctions and (2) organizing the cytoskeleton and cell adhesion structures of epithelia and carcinoma cells. During apoptosis, the encoded protein is degraded in a caspase-dependent manner. The aberrant regulation of this gene contributes to tumor cell invasion and metastasis. Three splice variants that encode different isoforms have been identified for this gene.
Protein Size (# AA):
634
Molecular Weight:
71 kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express CTTN.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express CTTN.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human CTTN
Predicted Species Reactivity:
Human
Tested Species Reactivity:
Human
Peptide Sequence:
Synthetic peptide located within the following region: KDKVDKSAVGFEYQGKTEKHESQKDYVKGFGGKFGVQTDRQDKCALGWDH
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-CTTN (ARP87102_P050) antibody is Catalog # AAP87102
Datasheets/Manuals:
Printable datasheet for anti-CTTN (ARP87102_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...