SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP97804_P050
Price: $0.00
SKU
ARP97804_P050
Availability: Domestic: within 24 hours delivery | International: 3-5 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-CTSL (ARP97804_P050) antibody
Product Info
Tested Species ReactivityMouse
Predicted Species ReactivityMouse
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of mouse CTSL
PurificationAffinity purified
Peptide SequenceSynthetic peptide located within the following region: AMDASHPSLQFYSSGIYYEPNCSSKNLDHGVLLVGYGYEGTDSNKNKYWL
Concentration0.5 mg/ml
Blocking PeptideFor anti-CTSL (ARP97804_P050) antibody is Catalog # AAP97804
Gene SymbolCTSL
Gene Full Namecathepsin L
Alias SymbolsME, fs, MEP, nkt, CatL, Ctsl1, 1190035F06Rik
NCBI Gene Id13039
Protein Namecathepsin L1
Description of TargetThis gene encodes a member of the peptidase C1 (papain) family of cysteine proteases. The encoded preproprotein is proteolytically processed to generate multiple protein products. These products include the activation peptide and the cathepsin L1 heavy and light chains. The mature enzyme appears to be important in embryonic development through its processing of histone H3 and may play a role in disease progression in a model of kidney disease. Homozygous knockout mice for this gene exhibit hair loss, skin thickening, bone and heart defects, and enhanced susceptibility to bacterial infection. A pseudogene of this gene has been identified in the genome.
Uniprot IDP06797
Protein Accession #NP_034114.1
Nucleotide Accession #NM_009984.4
Protein Size (# AA)334
Molecular Weight36 kDa
  1. What is the species homology for "CTSL Antibody - middle region (ARP97804_P050)"?

    The tested species reactivity for this item is "Mouse". This antibody is predicted to have homology to "Mouse".

  2. How long will it take to receive "CTSL Antibody - middle region (ARP97804_P050)"?

    This item is available "Domestic: within 24 hours delivery | International: 3-5 days".

  3. What buffer format is "CTSL Antibody - middle region (ARP97804_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "CTSL Antibody - middle region (ARP97804_P050)"?

    This target may also be called "ME, fs, MEP, nkt, CatL, Ctsl1, 1190035F06Rik" in publications.

  5. What is the shipping cost for "CTSL Antibody - middle region (ARP97804_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "CTSL Antibody - middle region (ARP97804_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "CTSL Antibody - middle region (ARP97804_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "36 kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "CTSL Antibody - middle region (ARP97804_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "CTSL"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "CTSL"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "CTSL"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "CTSL"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "CTSL"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "CTSL"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:CTSL Antibody - middle region (ARP97804_P050)
Your Rating