Search Antibody, Protein, and ELISA Kit Solutions

Ctsd Antibody - C-terminal region (ARP41481_P050)

100 ul

Regular Price: $319.00

Special Price: $229.00

In Stock
Request Bulk Order Quote

Conjugation Options

ARP41481_P050-FITC Conjugated

ARP41481_P050-HRP Conjugated

ARP41481_P050-Biotin Conjugated

Tested Species Reactivity:
Human, Mouse
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item:
This antibody may replace item sc-170717 from Santa Cruz Biotechnology.
The immunogen is a synthetic peptide corresponding to a region of Mouse
Affinity Purified
Predicted Homology Based on Immunogen Sequence:
Cow: 86%; Dog: 79%; Guinea Pig: 93%; Horse: 86%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 93%; Yeast: 92%; Zebrafish: 92%
Complete computational species homology data:
Anti-Ctsd (ARP41481_P050)
Peptide Sequence:
Synthetic peptide located within the following region: KTICLSGFMGMDIPPPSGPLWILGDVFIGSYYTVFDRDNNRVGFANAVVL
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-Ctsd (ARP41481_P050) antibody is Catalog # AAP41481 (Previous Catalog # AAPS09403)
Printable datasheet for anti-Ctsd (ARP41481_P050) antibody

Gambarte Tudela, J; Capmany, A; Romao, M; Quintero, C; Miserey-Lenkei, S; Raposo, G; Goud, B; Damiani, MT; The late endocytic Rab39a GTPase regulates the interaction between multivesicular bodies and chlamydial inclusions. 128, 3068-81 (2015). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish 26163492

Gene Symbol:
Official Gene Full Name:
Cathepsin D
Alias Symbols:
CD, CatD
NCBI Gene Id:
Protein Name:
Cathepsin D
Description of Target:
Ctsd is an acid protease active in intracellular protein breakdown.
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Protein Size (# AA):
Molecular Weight:
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express Ctsd.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express Ctsd.

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...