Catalog No: ARP60116_P050
Price: $0.00
SKU
ARP60116_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-CTSC (ARP60116_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Cow, Dog, Horse
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human CTSC
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 86%; Dog: 79%; Horse: 86%; Human: 100%; Mouse: 79%
Peptide SequenceSynthetic peptide located within the following region: WTATTYMEYETLTLGDMIRRSGGHSRKIPRPKPAPLTAEIQQKILHLPTS
Concentration0.5 mg/ml
Blocking PeptideFor anti-CTSC (ARP60116_P050) antibody is Catalog # AAP60116 (Previous Catalog # AAPP46256)
Publications

Cathepsin B Is Upregulated and Mediates ECM Degradation in Colon Adenocarcinoma HT29 Cells Overexpressing Snail. Cells. 8, (2019). 30818851

Gene SymbolCTSC
Gene Full NameCathepsin C
Alias SymbolsJP, HMS, JPD, PLS, CPPI, DPP1, DPPI, PALS, DPP-I, PDON1
NCBI Gene Id1075
Protein NameDipeptidyl peptidase 1
Description of TargetCTSC is a member of the peptidase C1 family, is a lysosomal cysteine proteinase that appears to be a central coordinator for activation of many serine proteinases in immune/inflammatory cells. It is composed of a dimer of disulfide-linked heavy and light chains, both produced from a single protein precursor, and a residual portion of the propeptide acts as an intramolecular chaperone for the folding and stabilization of the mature enzyme. This enzyme requires chloride ions for activity and can degrade glucagon. Defects in CTSC have been shown to be a cause of Papillon-Lefevre syndrome, an autosomal recessive disorder characterized by palmoplantar keratosis and periodontitis.
Uniprot IDP53634
Protein Accession #NP_001805
Nucleotide Accession #NM_001814
Protein Size (# AA)463
Molecular Weight8kDa
Protein InteractionsSUMO1; UBC; NEDD8; ARMC9; ANKMY2; ARIH1; UBA2; ADSL; FBXO6; XRN2; CAPN1; CD81; CTSC; CTSL;
  1. What is the species homology for "CTSC Antibody - middle region (ARP60116_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Cow, Dog, Horse".

  2. How long will it take to receive "CTSC Antibody - middle region (ARP60116_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "CTSC Antibody - middle region (ARP60116_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "CTSC Antibody - middle region (ARP60116_P050)"?

    This target may also be called "JP, HMS, JPD, PLS, CPPI, DPP1, DPPI, PALS, DPP-I, PDON1" in publications.

  5. What is the shipping cost for "CTSC Antibody - middle region (ARP60116_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "CTSC Antibody - middle region (ARP60116_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "CTSC Antibody - middle region (ARP60116_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "8kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "CTSC Antibody - middle region (ARP60116_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "CTSC"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "CTSC"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "CTSC"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "CTSC"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "CTSC"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "CTSC"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:CTSC Antibody - middle region (ARP60116_P050)
Your Rating
We found other products you might like!