Search Antibody, Protein, and ELISA Kit Solutions

CTSA Antibody - N-terminal region (ARP80794_P050)

100 ul

Regular Price: $289.00

Special Price: $229.00

In Stock
Request Bulk Order Quote

Tested Species Reactivity:
Predicted Species Reactivity:
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
Official Gene Full Name:
cathepsin A
NCBI Gene Id:
Protein Name:
Lysosomal protective protein
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Description of Target:
This gene encodes a member of the peptidase S10 family of serine carboxypeptidases. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein that is proteolytically processed to generate two chains that comprise the heterodimeric active enzyme. This enzyme possesses deamidase, esterase and carboxypeptidase activities and acts as a scaffold in the lysosomal multienzyme complex. Mutations in this gene are associated with galactosialidosis.
Protein Size (# AA):
Molecular Weight:
54 kDa
Affinity purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express CTSA.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express CTSA.
The immunogen is a synthetic peptide directed towards the N terminal region of human CTSA
Peptide Sequence:
Synthetic peptide located within the following region: DQDEIQRLPGLAKQPSFRQYSGYLKGSGSKHLHYWFVESQKDPENSPVVL
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-CTSA (ARP80794_P050) antibody is Catalog # AAP80794
Printable datasheet for anti-CTSA (ARP80794_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...