Size:100 ul
Special Price $229.00 Regular Price $289.00
In Stock
SKU
P100601_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

P100601_P050-FITC Conjugated

P100601_P050-HRP Conjugated

P100601_P050-Biotin Conjugated

CTNNB1 Antibody - C-terminal region (P100601_P050)

Rating:
80% of 100
Catalog#: P100601_P050
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species ReactivityHuman
Predicted Species ReactivityDog, Guinea Pig, Horse, Human, Mouse, Rabbit, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationCHIP, WB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement ItemThis antibody may replace item sc-116622 from Santa Cruz Biotechnology.
ImmunogenThe immunogen is a synthetic peptide directed towards the C-terminal region of human CTNNB1
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceDog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Zebrafish: 100%
Complete computational species homology dataAnti-CTNNB1 (P100601_P050)
Peptide SequenceSynthetic peptide located within the following region: RTEPMAWNETADLGLDIGAQGEPLGYRQDDPSYRSFHSGGYGQDALGMDP
ConcentrationBatch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking PeptideFor anti-CTNNB1 (P100601_P050) antibody is Catalog # AAP30904 (Previous Catalog # AAPP01628)
Datasheets/ManualsPrintable datasheet for anti-CTNNB1 (P100601_P050) antibody
Sample Type Confirmation

CTNNB1 is supported by BioGPS gene expression data to be expressed in HCT116

Target ReferenceJiang,X., (2008) Cancer Cell 13 (6), 529-541
Publications

Li, S; Yang, X; Tang, S; Zhang, X; Feng, Z; Cui, S; Repair of massively defected hemi-joints using demineralized osteoarticular allografts with protected cartilage. 26, 227 (2015). CHIP, WB, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Zebrafish 26319778

Gene SymbolCTNNB1
Official Gene Full NameCatenin (cadherin-associated protein), beta 1, 88kDa
Alias SymbolsCTNNB, DKFZp686D02253, FLJ25606, FLJ37923
NCBI Gene Id1499
Protein NameCatenin beta-1
Description of TargetBeta-catenin is an adherens junction protein. Adherens junctions (AJs; also called the zonula adherens) are critical for the establishment and maintenance of epithelial layers, such as those lining organ surfaces. AJs mediate adhesion between cells, communicate a signal that neighboring cells are present, and anchor the actin cytoskeleton. In serving these roles, AJs regulate normal cell growth and behavior. At several stages of embryogenesis, wound healing, and tumor cell metastasis, cells form and leave epithelia. This process, which involves the disruption and reestablishment of epithelial cell-cell contacts, may be regulated by the disassembly and assembly of AJs. AJs may also function in the transmission of the 'contact inhibition' signal, which instructs cells to stop dividing once an epithelial sheet is complete.Beta-catenin is an adherens junction protein. Adherens junctions (AJs; also called the zonula adherens) are critical for the establishment and maintenance of epithelial layers, such as those lining organ surfaces. AJs mediate adhesion between cells, communicate a signal that neighboring cells are present, and anchor the actin cytoskeleton. In serving these roles, AJs regulate normal cell growth and behavior. At several stages of embryogenesis, wound healing, and tumor cell metastasis, cells form and leave epithelia. This process, which involves the disruption and reestablishment of epithelial cell-cell contacts, may be regulated by the disassembly and assembly of AJs. AJs may also function in the transmission of the 'contact inhibition' signal, which instructs cells to stop dividing once an epithelial sheet is complete.[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-54 DA216720.1 1-54 55-2626 X87838.1 1-2572 2627-3720 AC104307.2 83770-84863
Swissprot IdP35222
Protein Accession #NP_001895
Nucleotide Accession #NM_001904
Protein Size (# AA)781
Molecular Weight85kDa
Tissue ToolFind tissues and cell lines supported by DNA array analysis to express CTNNB1.
RNA SeqFind tissues and cell lines supported by RNA-seq analysis to express CTNNB1.
Protein InteractionsPPARD; PLA2G4A; FBXO45; BTRC; SUMO1; UBC; HUWE1; CDH5; CDH2; TCF4; TBL1X; SOX1; SKP1; RNF220; CACYBP; FBXW11; SUMO2; SIAH1; Apc2; COPS5; RNF14; CDH1; SP1; KCTD1; MDM2; UBE2B; GSK3B; NEK2; RBX1; PTGS2; STRN3; LATS2; APC; ELAVL1; AMOT; ABL1; AXIN1; CBL; LEF
Write Your Own Review
You're reviewing:CTNNB1 Antibody - C-terminal region (P100601_P050)
Your Rating
Aviva Tips and Tricks
Aviva HIS tag Deal
Aviva ChIP Antibodies
Aviva Live Chat