Search Antibody, Protein, and ELISA Kit Solutions

CTNNB1 Antibody - C-terminal region (P100601_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

P100601_P050-FITC Conjugated

P100601_P050-HRP Conjugated

P100601_P050-Biotin Conjugated

Tested Species Reactivity:
Predicted Species Reactivity:
Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Zebrafish
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
Official Gene Full Name:
Catenin (cadherin-associated protein), beta 1, 88kDa
NCBI Gene Id:
Protein Name:
Catenin beta-1
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
CTNNB, DKFZp686D02253, FLJ25606, FLJ37923
Replacement Item:
This antibody may replace item sc-116622 from Santa Cruz Biotechnology.
Description of Target:
Beta-catenin is an adherens junction protein. Adherens junctions (AJs; also called the zonula adherens) are critical for the establishment and maintenance of epithelial layers, such as those lining organ surfaces. AJs mediate adhesion between cells, communicate a signal that neighboring cells are present, and anchor the actin cytoskeleton. In serving these roles, AJs regulate normal cell growth and behavior. At several stages of embryogenesis, wound healing, and tumor cell metastasis, cells form and leave epithelia. This process, which involves the disruption and reestablishment of epithelial cell-cell contacts, may be regulated by the disassembly and assembly of AJs. AJs may also function in the transmission of the 'contact inhibition' signal, which instructs cells to stop dividing once an epithelial sheet is complete.Beta-catenin is an adherens junction protein. Adherens junctions (AJs; also called the zonula adherens) are critical for the establishment and maintenance of epithelial layers, such as those lining organ surfaces. AJs mediate adhesion between cells, communicate a signal that neighboring cells are present, and anchor the actin cytoskeleton. In serving these roles, AJs regulate normal cell growth and behavior. At several stages of embryogenesis, wound healing, and tumor cell metastasis, cells form and leave epithelia. This process, which involves the disruption and reestablishment of epithelial cell-cell contacts, may be regulated by the disassembly and assembly of AJs. AJs may also function in the transmission of the 'contact inhibition' signal, which instructs cells to stop dividing once an epithelial sheet is complete.[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-54 DA216720.1 1-54 55-2626 X87838.1 1-2572 2627-3720 AC104307.2 83770-84863
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express CTNNB1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express CTNNB1.
The immunogen is a synthetic peptide directed towards the C-terminal region of human CTNNB1
Predicted Homology Based on Immunogen Sequence:
Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Zebrafish: 100%
Complete computational species homology data:
Anti-CTNNB1 (P100601_P050)
Peptide Sequence:
Synthetic peptide located within the following region: RTEPMAWNETADLGLDIGAQGEPLGYRQDDPSYRSFHSGGYGQDALGMDP
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-CTNNB1 (P100601_P050) antibody is Catalog # AAP30904 (Previous Catalog # AAPP01628)
Printable datasheet for anti-CTNNB1 (P100601_P050) antibody
Sample Type Confirmation:

CTNNB1 is supported by BioGPS gene expression data to be expressed in HCT116

Target Reference:
Jiang,X., (2008) Cancer Cell 13 (6), 529-541

Li, S; Yang, X; Tang, S; Zhang, X; Feng, Z; Cui, S; Repair of massively defected hemi-joints using demineralized osteoarticular allografts with protected cartilage. 26, 227 (2015). CHIP, WB, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Zebrafish 26319778

Product Reviews

Average Rating:
1 review
5 star
4 star
3 star
2 star
1 star
  • Date - Newest First
  • Date - Newest First
  • Date - Latest First
  • Highest Rated
  • Lowest Rated
  • Most Helpful
  • Ownership

1 Item(s)

289/10/2017 16:08
  • Quality:
  • Overall Experience:
Product Review: CTNNB1 antibody - C-terminal region (P100601_P050)
Great product
Show more comments (-2) Hide comments

1 Item(s)

What kind of abuse are you reporting?
    Please, wait...