Search Antibody, Protein, and ELISA Kit Solutions

CTNNB1 Antibody - C-terminal region (AVARP14001_T100)

100 ul

Regular Price: $249.00

Special Price: $229.00

In Stock
Request Bulk Order Quote

Conjugation Options

AVARP14001_T100-FITC Conjugated

AVARP14001_T100-HRP Conjugated

AVARP14001_T100-Biotin Conjugated

Tested Species Reactivity:
Human, Mouse
Predicted Species Reactivity:
Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Zebrafish
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item:
This antibody may replace item sc-116622, HPA029159
The immunogen is a synthetic peptide directed towards the C terminal region of human CTNNB1
Protein A purified
Predicted Homology Based on Immunogen Sequence:
Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Zebrafish: 100%
Complete computational species homology data:
Anti-CTNNB1 (AVARP14001_T100)
Peptide Sequence:
Synthetic peptide located within the following region: DPMMEHEMGGHHPGADYPVDGLPDLGHAQDLMDGLPPGDSNQLAWFDTDL
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-CTNNB1 (AVARP14001_T100) antibody is Catalog # AAP30238 (Previous Catalog # AAPS00103)
Printable datasheet for anti-CTNNB1 (AVARP14001_T100) antibody
Sample Type Confirmation:

CTNNB1 is supported by BioGPS gene expression data to be expressed in HCT116

Target Reference:
Onilude OE,.(2006) Cancer Genet Cytogenet. Jul 15;168(2):158-61.
Gene Symbol:
Official Gene Full Name:
Catenin (cadherin-associated protein), beta 1, 88kDa
Alias Symbols:
NCBI Gene Id:
Description of Target:
CTNNB1 is involved in the regulation of cell adhesion and in signal transduction through the Wnt pathway.
Protein Accession #:
Protein Size (# AA):
Molecular Weight:
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express CTNNB1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express CTNNB1.
Protein Interactions:

Product Reviews

Average Rating:
1 review
5 star
4 star
3 star
2 star
1 star
  • Date - Newest First
  • Date - Newest First
  • Date - Latest First
  • Highest Rated
  • Lowest Rated
  • Most Helpful
  • Ownership

1 Item(s)

289/10/2017 16:07
  • Quality:
  • Overall Experience:
Product Review: CTNNB1 antibody - C-terminal region (AVARP14001_T100)
Great product
Show more comments (-2) Hide comments

1 Item(s)

What kind of abuse are you reporting?
    Please, wait...