Size:100 ul
Special Price $229.00 Regular Price $249.00
In stock
SKU
AVARP14001_T100
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

AVARP14001_T100-FITC Conjugated

AVARP14001_T100-HRP Conjugated

AVARP14001_T100-Biotin Conjugated

More Information
Tested Species Reactivity Human, Mouse
Predicted Species Reactivity Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Zebrafish
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application IHC, WB, IP
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-116622, HPA029159
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human CTNNB1
Purification Protein A purified
Predicted Homology Based on Immunogen Sequence Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Zebrafish: 100%
Complete computational species homology data Anti-CTNNB1 (AVARP14001_T100)
Peptide Sequence Synthetic peptide located within the following region: DPMMEHEMGGHHPGADYPVDGLPDLGHAQDLMDGLPPGDSNQLAWFDTDL
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-CTNNB1 (AVARP14001_T100) antibody is Catalog # AAP30238 (Previous Catalog # AAPS00103)
Datasheets/Manuals Printable datasheet for anti-CTNNB1 (AVARP14001_T100) antibody
Sample Type Confirmation

CTNNB1 is supported by BioGPS gene expression data to be expressed in HCT116

Target Reference Onilude OE,.(2006) Cancer Genet Cytogenet. Jul 15;168(2):158-61.
Gene Symbol CTNNB1
Official Gene Full Name Catenin (cadherin-associated protein), beta 1, 88kDa
Alias Symbols CTNNB
NCBI Gene Id 1499
Description of Target CTNNB1 is involved in the regulation of cell adhesion and in signal transduction through the Wnt pathway.
Protein Accession # XP_001133664
Protein Size (# AA) 694
Molecular Weight 76kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express CTNNB1.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express CTNNB1.
Protein Interactions PPARD; PLA2G4A; FBXO45; BTRC; SUMO1; UBC; HUWE1; CDH5; CDH2; TCF4; TBL1X; SOX1; SKP1; RNF220; CACYBP; FBXW11; SUMO2; SIAH1; Apc2; COPS5; RNF14; CDH1; SP1; KCTD1; MDM2; UBE2B; GSK3B; NEK2; RBX1; PTGS2; STRN3; LATS2; APC; ELAVL1; AMOT; ABL1; AXIN1; CBL; LEF
Write Your Own Review
You're reviewing:CTNNB1 Antibody - C-terminal region (AVARP14001_T100)
Your Rating