- Tested Species Reactivity:
- Human
- Predicted Species Reactivity:
- Human
- Product Format:
- Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
- Clonality:
- Polyclonal
- Host:
- Rabbit
- Application:
- WB
- Reconstitution and Storage:
- For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
- Gene Symbol:
- CTNNB1
- Official Gene Full Name:
- catenin beta 1
- NCBI Gene Id:
- 1499
- Protein Name:
- Catenin beta-1
- Swissprot Id:
- P35222
- Protein Accession #:
- NP_001091679.1
- Nucleotide Accession #:
- NM_001098209.1
- Alias Symbols:
- CTNNB, MRD19, armadillo
- Description of Target:
- The protein encoded by this gene is part of a complex of proteins that constitute adherens junctions (AJs). AJs are necessary for the creation and maintenance of epithelial cell layers by regulating cell growth and adhesion between cells. The encoded protein also anchors the actin cytoskeleton and may be responsible for transmitting the contact inhibition signal that causes cells to stop dividing once the epithelial sheet is complete. Finally, this protein binds to the product of the APC gene, which is mutated in adenomatous polyposis of the colon. Mutations in this gene are a cause of colorectal cancer (CRC), pilomatrixoma (PTR), medulloblastoma (MDB), and ovarian cancer. Alternative splicing results in multiple transcript variants.
- Protein Size (# AA):
- 781
- Molecular Weight:
- 85 kDa
- Purification:
- Affinity purified
- Tissue Tool:
- Find tissues and cell lines supported by DNA array analysis to express CTNNB1.
- RNA Seq:
- Find tissues and cell lines supported by RNA-seq analysis to express CTNNB1.
- Immunogen:
- The immunogen is a synthetic peptide directed towards the C terminal region of human CTNNB1
- Peptide Sequence:
- Synthetic peptide located within the following region: ETADLGLDIGAQGEPLGYRQDDPSYRSFHSGGYGQDALGMDPMMEHEMGG
- Concentration:
- Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
- Blocking Peptide:
- For anti-CTNNB1 (ARP97257_P050) antibody is Catalog # AAP97257
- Datasheets/Manuals:
- Printable datasheet for anti-LETM1 (ARP97257_P050) antibody
Product Reviews
- Protocol:
- Tips Information:
See our General FAQ page.
