Search Antibody, Protein, and ELISA Kit Solutions

CTBP1 Antibody - C-terminal region (ARP32468_P050)

100 ul

Regular Price: $289.00

Special Price: $229.00

In Stock
Request Bulk Order Quote

Conjugation Options

ARP32468_P050-FITC Conjugated

ARP32468_P050-HRP Conjugated

ARP32468_P050-Biotin Conjugated

Tested Species Reactivity:
Human, Mouse
Predicted Species Reactivity:
Dog, Horse, Human, Mouse, Pig, Rat
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
WB, IHC
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item:
This antibody may replace item sc-11390 from Santa Cruz Biotechnology.
Immunogen:
The immunogen is a synthetic peptide directed towards the C terminal region of human CTBP1
Purification:
Affinity Purified
Predicted Homology Based on Immunogen Sequence:
Dog: 100%; Horse: 93%; Human: 100%; Mouse: 93%; Pig: 100%; Rat: 100%
Complete computational species homology data:
Anti-CTBP1 (ARP32468_P050)
Peptide Sequence:
Synthetic peptide located within the following region: TGIPAAVEGIVPSAMSLSHGLPPVAHPPHAPSPGQTVKPEADRDHASDQL
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-CTBP1 (ARP32468_P050) antibody is Catalog # AAP32468 (Previous Catalog # AAPP03466)
Datasheets/Manuals:
Printable datasheet for anti-CTBP1 (ARP32468_P050) antibody
Sample Type Confirmation:

CTBP1 is strongly supported by BioGPS gene expression data to be expressed in Jurkat

Target Reference:
Lin,X., et al., (2003) Mol. Cell. Biol. 23 (24), 9081-9093
Publications:

Anti-CLDN13 ARP32468_P050 has recently been referenced in the following publications:

Mittal, M. K., Singh, K., Misra, S. & Chaudhuri, G. SLUG-induced elevation of D1 cyclin in breast cancer cells through the inhibition of its ubiquitination. J. Biol. Chem. 286, 469–79 (2011). 21044962

Gene Symbol:
CTBP1
Official Gene Full Name:
C-terminal binding protein 1
Alias Symbols:
BARS
NCBI Gene Id:
1487
Protein Name:
C-terminal-binding protein 1
Description of Target:
The phosphoprotein C-terminal binding protein 1 (CTBP-1) binds the C-terminus of adenovirus E1A protein. CTBP-1 is a transcriptional repressor and may play a role during cellular proliferation. A second closely related gene, CTBP2, maps to chromosome 21.
Swissprot Id:
Q13363
Protein Accession #:
NP_001319
Nucleotide Accession #:
NM_001328
Protein Size (# AA):
440
Molecular Weight:
48kDa
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express CTBP1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express CTBP1.
Protein Interactions:
CTBP2; CTBP1; CRY2; NOL4L; FOXP2; DMRTB1; TSHZ3; BCAS3; PLCB1; CEP68; KLF12; IKZF1; NOL4; TGIF1; MAPK9; PRKAA1; HOXB5; TCF4; SNRPN; DGCR6; NRIP1; FUNDC1; LNX1; LCOR; RNF111; KLF3; IKZF2; RAI2; ZBTB18; ARNT2; ZEB2; PIAS2; CDC23; LCORL; MARCH10; SMAD6; UBC;

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...