Now Offering Over 102,157 Antibodies & 44,722 Antigens!

CTBP1 antibody - C-terminal region (ARP32468_P050)

100 ul
$289.00
In Stock

Conjugation Options

ARP32468_P050-FITC Conjugated

ARP32468_P050-HRP Conjugated

ARP32468_P050-Biotin Conjugated

Gene Symbol:
CTBP1
NCBI Gene Id:
1487
Official Gene Full Name:
C-terminal binding protein 1
Protein Name:
C-terminal-binding protein 1
Swissprot Id:
Q13363
Protein Accession #:
NP_001319
Nucleotide Accession #:
NM_001328
Alias Symbols:
BARS
Replacement Item:
This antibody may replace item sc-11390 from Santa Cruz Biotechnology.
Description of Target:
The phosphoprotein C-terminal binding protein 1 (CTBP-1) binds the C-terminus of adenovirus E1A protein. CTBP-1 is a transcriptional repressor and may play a role during cellular proliferation. A second closely related gene, CTBP2, maps to chromosome 21.
Protein Size (# AA):
440
Molecular Weight:
48kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB, IHC
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express CTBP1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express CTBP1.
Immunogen:
The immunogen is a synthetic peptide directed towards the C terminal region of human CTBP1
Species Reactivity:
Dog, Horse, Human, Mouse, Pig, Rat
Predicted Homology Based on Immunogen Sequence:
Dog: 100%; Horse: 93%; Human: 100%; Mouse: 93%; Pig: 100%; Rat: 100%
Complete computational species homology data:
Anti-CTBP1 (ARP32468_P050)
Peptide Sequence:
Synthetic peptide located within the following region: TGIPAAVEGIVPSAMSLSHGLPPVAHPPHAPSPGQTVKPEADRDHASDQL
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
CTBP2; CTBP1; CRY2; NOL4L; FOXP2; DMRTB1; TSHZ3; BCAS3; PLCB1; CEP68; KLF12; IKZF1; NOL4; TGIF1; MAPK9; PRKAA1; HOXB5; TCF4; SNRPN; DGCR6; NRIP1; FUNDC1; LNX1; LCOR; RNF111; KLF3; IKZF2; RAI2; ZBTB18; ARNT2; ZEB2; PIAS2; CDC23; LCORL; MARCH10; SMAD6; UBC;
Blocking Peptide:
For anti-CTBP1 (ARP32468_P050) antibody is Catalog # AAP32468 (Previous Catalog # AAPP03466)
Datasheets/Manuals:
Printable datasheet for anti-CTBP1 (ARP32468_P050) antibody
Sample Type Confirmation:

CTBP1 is strongly supported by BioGPS gene expression data to be expressed in Jurkat

Target Reference:
Lin,X., et al., (2003) Mol. Cell. Biol. 23 (24), 9081-9093
Publications:

Anti-CLDN13 ARP32468_P050 has recently been referenced in the following publications:

Mittal, M. K., Singh, K., Misra, S. & Chaudhuri, G. SLUG-induced elevation of D1 cyclin in breast cancer cells through the inhibition of its ubiquitination. J. Biol. Chem. 286, 469–79 (2011). 21044962

Tell us what you think about this item!

Write A Review
    Please, wait...