Search Antibody, Protein, and ELISA Kit Solutions

CTA-126B4.3 Antibody - N-terminal region (ARP40817_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP40817_P050-FITC Conjugated

ARP40817_P050-HRP Conjugated

ARP40817_P050-Biotin Conjugated

Gene Symbol:
RRP7A
Official Gene Full Name:
Ribosomal RNA processing 7 homolog A (S. cerevisiae)
NCBI Gene Id:
27341
Protein Name:
Ribosomal RNA-processing protein 7 homolog A
Swissprot Id:
Q9Y3A4
Protein Accession #:
NP_056518
Nucleotide Accession #:
NM_015703
Alias Symbols:
BK126B4.3, CGI-96, MGC150422, MGC150423, CTA-126B4.3
Replacement Item:
This antibody may replace item sc-377210 from Santa Cruz Biotechnology.
Description of Target:
The exact function of CTA-126B4.3 remains unknown.
Protein Size (# AA):
280
Molecular Weight:
32kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express CTA-126B4.3.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express CTA-126B4.3.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human CTA-126B4.3
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Tested Species Reactivity:
Human
Predicted Homology Based on Immunogen Sequence:
Cow: 92%; Dog: 83%; Guinea Pig: 75%; Horse: 100%; Human: 100%; Mouse: 92%; Pig: 92%; Rabbit: 83%; Rat: 100%
Complete computational species homology data:
Anti-CTA-126B4.3 (ARP40817_P050)
Peptide Sequence:
Synthetic peptide located within the following region: NVPPYCTEESLSRLLSTCGLVQSVELQEKPDLAESPKESRSKFFHPKPVP
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
TFIP11; UBC; RNF2; UPF2; MPG; HP1BP3; GNL3; NCSTN; ACIN1; U2AF2; EBNA1BP2; MYBBP1A; MATR3; RBM39; NOLC1; DDX21; U2AF1; TPR; RANBP2; NHP2L1; NFIA; HNRNPM; HNRNPU; HNRNPC; SIRT7; MAPK6;
Blocking Peptide:
For anti-RRP7A (ARP40817_P050) antibody is Catalog # AAP40817 (Previous Catalog # AAPY01069)
Datasheets/Manuals:
Printable datasheet for anti-RRP7A (ARP40817_P050) antibody
Target Reference:
Nousiainen,M., (2006) Proc. Natl. Acad. Sci. U.S.A. 103 (14), 5391-5396

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...