Catalog No: ARP53596_P050
Price: $0.00
SKU
ARP53596_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-CSNK2A2 (ARP53596_P050) antibody
Product Info
ReferenceGottlieb,D.J., (er) BMC Med. Genet. 8 SUPPL 1, S9 (2007)
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Yeast
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB, IP
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human CSNK2A2
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 86%; Pig: 100%; Rabbit: 100%; Rat: 86%; Yeast: 92%
Peptide SequenceSynthetic peptide located within the following region: LLDKLLRYDHQQRLTAKEAMEHPYFYPVVKEQSQPCADNAVLSSGLTAAR
Concentration0.5 mg/ml
Blocking PeptideFor anti-CSNK2A2 (ARP53596_P050) antibody is Catalog # AAP53596 (Previous Catalog # AAPP31115)
Sample Type Confirmation

CSNK2A2 is supported by BioGPS gene expression data to be expressed in HepG2

Subunitalpha'
Gene SymbolCSNK2A2
Gene Full NameCasein kinase 2, alpha prime polypeptide
Alias SymbolsCK2A2, CSNK2A1, CK2alpha'
NCBI Gene Id1459
Protein NameCasein kinase II subunit alpha'
Description of TargetCSNK2A2 belongs to the protein kinase superfamily, Ser/Thr protein kinase family, CK2 subfamily. It contains 1 protein kinase domain. Casein kinases are operationally defined by their preferential utilization of acidic proteins such as caseins as substrates. The alpha and alpha' chains contain the catalytic site. CSNK2A2 participates in Wnt signaling. It phosphorylates 'Ser-392' of p53/TP53 following UV irradiation.
Uniprot IDP19784
Protein Accession #NP_001887
Nucleotide Accession #NM_001896
Protein Size (# AA)350
Molecular Weight39kDa
Protein InteractionsTRIM41; UBC; SUMO1; NEDD8; POP1; WWOX; RPA3; RPA2; RPA1; rev; NAP1; CAP2; CSNK2B; CDK16; CDK11A; GPC4; CSNK2A1; CDC5L; CDK11B; BCR; BRD2; RNF2; RING1; PNN; PLRG1; PIP4K2A; KMT2A; HSP90AA1; PRMT1; HADHB; ZC3H18; HDGFRP2; NIFK; TCOF1; SOX2; SDC2; C18orf25;
  1. What is the species homology for "CSNK2A2 Antibody - C-terminal region (ARP53596_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Yeast".

  2. How long will it take to receive "CSNK2A2 Antibody - C-terminal region (ARP53596_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "CSNK2A2 Antibody - C-terminal region (ARP53596_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "CSNK2A2 Antibody - C-terminal region (ARP53596_P050)"?

    This target may also be called "CK2A2, CSNK2A1, CK2alpha'" in publications.

  5. What is the shipping cost for "CSNK2A2 Antibody - C-terminal region (ARP53596_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "CSNK2A2 Antibody - C-terminal region (ARP53596_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "CSNK2A2 Antibody - C-terminal region (ARP53596_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "39kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "CSNK2A2 Antibody - C-terminal region (ARP53596_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "CSNK2A2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "CSNK2A2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "CSNK2A2"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "CSNK2A2"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "CSNK2A2"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "CSNK2A2"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:CSNK2A2 Antibody - C-terminal region (ARP53596_P050)
Your Rating
We found other products you might like!