Catalog No: ARP51990_P050
Price: $0.00
SKU
ARP51990_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-CSNK2A1 (ARP51990_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Yeast, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human CSNK2A1
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 100%; Zebrafish: 100%
Peptide SequenceSynthetic peptide located within the following region: LGCMLASMIFRKEPFFHGHDNYDQLVRIAKVLGTEDLYDYIDKYNIELDP
Concentration0.5 mg/ml
Blocking PeptideFor anti-CSNK2A1 (ARP51990_P050) antibody is Catalog # AAP51990 (Previous Catalog # AAPP30215)
Sample Type Confirmation

CSNK2A1 is strongly supported by BioGPS gene expression data to be expressed in 721_B

Subunitalpha
ReferenceLehnert,S., (2008) Oncogene 27 (17), 2390-2400
Gene SymbolCSNK2A1
Gene Full NameCasein kinase 2, alpha 1 polypeptide
Alias SymbolsCKII, Cka1, Cka2, CK2A1, OCNDS
NCBI Gene Id1457
Protein NameCasein kinase II subunit alpha
Description of TargetCasein kinase II is a serine/threonine protein kinase that phosphorylates acidic proteins such as casein. The kinase exists as a tetramer and is composed of an alpha, an alpha-prime, and two beta subunits. The alpha subunits contain the catalytic activity while the beta subunits undergo autophosphorylation. CSNK2A1 represents the alpha subunit.Casein kinase II is a serine/threonine protein kinase that phosphorylates acidic proteins such as casein. The kinase exists as a tetramer and is composed of an alpha, an alpha-prime, and two beta subunits. The alpha subunits contain the catalytic activity while the beta subunits undergo autophosphorylation. The protein encoded by this gene represents the alpha subunit. While this gene is found on chromosome 20, a related transcribed pseudogene is found on chromosome 11. Three transcript variants encoding two different proteins have been found for this gene.
Uniprot IDP68400
Protein Accession #NP_001886
Nucleotide Accession #NM_001895
Protein Size (# AA)391
Molecular Weight45kDa
Protein InteractionsMAGEA11; HDAC3; RNF111; NFYA; SGT1; STAC3; SUGT1; THAP1; AKT1; AURKA; CEP76; TP53; CEP57; RPS3; EGFR; UBC; POP1; WWOX; RNF2; rev; NAP1; EPB41L2; CALD1; HECW2; CDK11A; CAV2; CSNK2B; RNF11; NRF1; MYH9; IGSF8; ICAM1; HMGA1; HDAC1; GCH1; ACE; CSNK2A2; PRNP; D
  1. What is the species homology for "CSNK2A1 Antibody - middle region (ARP51990_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Yeast, Zebrafish".

  2. How long will it take to receive "CSNK2A1 Antibody - middle region (ARP51990_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "CSNK2A1 Antibody - middle region (ARP51990_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "CSNK2A1 Antibody - middle region (ARP51990_P050)"?

    This target may also be called "CKII, Cka1, Cka2, CK2A1, OCNDS" in publications.

  5. What is the shipping cost for "CSNK2A1 Antibody - middle region (ARP51990_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "CSNK2A1 Antibody - middle region (ARP51990_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "CSNK2A1 Antibody - middle region (ARP51990_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "45kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "CSNK2A1 Antibody - middle region (ARP51990_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "CSNK2A1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "CSNK2A1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "CSNK2A1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "CSNK2A1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "CSNK2A1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "CSNK2A1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:CSNK2A1 Antibody - middle region (ARP51990_P050)
Your Rating
We found other products you might like!