Catalog No: ARP87032_P050
Price: $0.00
SKU
ARP87032_P050
Availability: Domestic: within 24 hours delivery | International: 3-5 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-CSNK1A1 (ARP87032_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human CSNK1A1
PurificationAffinity purified
Peptide SequenceSynthetic peptide located within the following region: KLFLIDFGLAKKYRDNRTRQHIPYREDKNLTGTARYASINAHLGIEQSRR
Concentration0.5 mg/ml
Blocking PeptideFor anti-CSNK1A1 (ARP87032_P050) antibody is Catalog # AAP87032
Gene SymbolCSNK1A1
Gene Full Namecasein kinase 1 alpha 1
Alias SymbolsCK1, CK1a, CKIa, HLCDGP1, PRO2975, HEL-S-77p
NCBI Gene Id1452
Protein Namecasein kinase I isoform alpha
Description of TargetCasein kinases are operationally defined by their preferential utilization of acidic proteins such as caseins as substrates. It can phosphorylate a large number of proteins. Participates in Wnt signaling. Phosphorylates CTNNB1 at 'Ser-45'. May phosphorylate PER1 and PER2. May play a role in segregating chromosomes during mitosis. May play a role in keratin cytoskeleton disassembly and thereby, it may regulate epithelial cell migration.
Uniprot IDP48729-3
Protein Accession #NP_001020276.1
Nucleotide Accession #NM_001025105.2
Protein Size (# AA)325
Molecular Weight35 kDa
  1. What is the species homology for "CSNK1A1 Antibody - middle region (ARP87032_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human".

  2. How long will it take to receive "CSNK1A1 Antibody - middle region (ARP87032_P050)"?

    This item is available "Domestic: within 24 hours delivery | International: 3-5 days".

  3. What buffer format is "CSNK1A1 Antibody - middle region (ARP87032_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "CSNK1A1 Antibody - middle region (ARP87032_P050)"?

    This target may also be called "CK1, CK1a, CKIa, HLCDGP1, PRO2975, HEL-S-77p" in publications.

  5. What is the shipping cost for "CSNK1A1 Antibody - middle region (ARP87032_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "CSNK1A1 Antibody - middle region (ARP87032_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "CSNK1A1 Antibody - middle region (ARP87032_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "35 kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "CSNK1A1 Antibody - middle region (ARP87032_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "CSNK1A1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "CSNK1A1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "CSNK1A1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "CSNK1A1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "CSNK1A1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "CSNK1A1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:CSNK1A1 Antibody - middle region (ARP87032_P050)
Your Rating
We found other products you might like!