CSH1 Antibody - middle region (ARP40350_T100)

Catalog No: ARP40350_T100

WB Suggested Anti-CSH1 Antibody Titration: 1.25ug/ml
ELISA Titer: 1:312500
Positive Control: Human Placenta

Rabbit Anti-CSH1 Antibody
Catalog Number: ARP40350
Paraffin Embedded Tissue: Human Stomach
Cellular Data: Epithelial cells of fundic gland
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Rat, Dog, Guinea Pig, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: IHC, WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CSH1
• Purification: Protein A purified
• Predicted Homology Based on Immunogen Sequence: Dog: 100%; Guinea Pig: 100%; Human: 100%; Rabbit: 100%; Rat: 100%
• Peptide Sequence: Synthetic peptide located within the following region: SMFANNLVYDTSDSDDYHLLKDLEEGIQTLMGRLEDGSRRTGQILKQTYS
• Concentration: 1.0 mg/ml
• Blocking Peptide: For anti-CSH1 (ARP40350_T100) antibody is Catalog # AAP40350 (Previous Catalog # AAPP10387)
• Reference: Walsh,S.T. (2006) J. Mol. Biol. 358 (3), 773-784

Target Info

• Gene Symbol: CSH1
• Gene Full Name: Chorionic somatomammotropin hormone 1 (placental lactogen)
• Alias Symbols: PL, CSA, CS-1, CSMT, GHB3, hCS-1, hCS-A
• NCBI Gene Id: 1442
• Protein Name: Chorionic somatomammotropin hormone
• Description of Target: CSH1 is a member of the somatotropin/prolactin family of hormones and plays an important role in growth control. This particular family member is expressed mainly in the placenta and utilizes multiple transcription initiation sites. Expression of the identical mature proteins for chorionic somatomammotropin hormones 1 and 2 is upregulated during development, although the ratio of 1 to 2 increases by term. Mutations in this gene result in placental lactogen deficiency and Silver-Russell syndrome.The protein encoded by this gene is a member of the somatotropin/prolactin family of hormones and plays an important role in growth control. The gene is located at the growth hormone locus on chromosome 17 along with four other related genes in the same transcriptional orientation; an arrangement which is thought to have evolved by a series of gene duplications. Although the five genes share a remarkably high degree of sequence identity, they are expressed selectively in different tissues. Alternative splicing generates additional isoforms of each of the five growth hormones, leading to further diversity and potential for specialization. This particular family member is expressed mainly in the placenta and utilizes multiple transcription initiation sites. Expression of the identical mature proteins for chorionic somatomammotropin hormones 1 and 2 is upregulated during development, although the ratio of 1 to 2 increases by term. Mutations in this gene result in placental lactogen deficiency and Silver-Russell syndrome.
• Uniprot ID: P01243
• Protein Accession #: NP_001308
• Nucleotide Accession #: NM_001317
• Protein Size (# AA): 217
• Molecular Weight: 24kDa
• Protein Interactions: PSMD9; PTPN12; SMAD9; SMAD4; SMAD2; PRLR; POLR2A; SMAD3;