Size:100 ul
Special Price $229.00 Regular Price $289.00
In stock
SKU
ARP47967_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP47967_P050-FITC Conjugated

ARP47967_P050-HRP Conjugated

ARP47967_P050-Biotin Conjugated

CSF2 Antibody - C-terminal region (ARP47967_P050)

Catalog#: ARP47967_P050
Domestic: within 24 hours delivery International: 3-5 business days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Human
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-111983 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the C region of human CSF2
Purification Affinity purified
Predicted Homology Based on Immunogen Sequence Dog: 79%; Goat: 93%; Guinea Pig: 93%; Horse: 79%; Human: 100%; Rabbit: 79%; Rat: 100%; Sheep: 93%
Complete computational species homology data Anti-CSF2 (ARP47967_P050)
Peptide Sequence Synthetic peptide located within the following region: QGLRGSLTKLKGPLTMMASHYKQHCPPTPETSCATQIITFESFKENLKDF
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-CSF2 (ARP47967_P050) antibody is Catalog # AAP47967
Datasheets/Manuals Printable datasheet for anti-CSF2 (ARP47967_P050) antibody
Gene Symbol CSF2
Official Gene Full Name colony stimulating factor 2
Alias Symbols GMCSF,
NCBI Gene Id 1437
Protein Name granulocyte-macrophage colony-stimulating factor
Description of Target The protein encoded by this gene is a cytokine that controls the production, differentiation, and function of granulocytes and macrophages. The active form of the protein is found extracellularly as a homodimer. This gene has been localized to a cluster of related genes at chromosome region 5q31, which is known to be associated with interstitial deletions in the 5q- syndrome and acute myelogenous leukemia. Other genes in the cluster include those encoding interleukins 4, 5, and 13.
Swissprot Id P04141
Protein Accession # NP_000749
Nucleotide Accession # NM_000758.3
Protein Size (# AA) 144
Molecular Weight 15 kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express CSF2.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express CSF2.
Protein Interactions MEOX2; PABPC1; HNRNPA0; SYNCRIP; ILF3; ILF2; HNRNPA2B1; HNRNPA1; CSF2; PRG2; IL3RA; CSF2RA; KITLG; SDC2; CSF2RB;
Write Your Own Review
You're reviewing:CSF2 Antibody - C-terminal region (ARP47967_P050)
Your Rating