Search Antibody, Protein, and ELISA Kit Solutions

CSF2 Antibody - C-terminal region (ARP47967_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP47967_P050-FITC Conjugated

ARP47967_P050-HRP Conjugated

ARP47967_P050-Biotin Conjugated

Gene Symbol:
CSF2
Official Gene Full Name:
colony stimulating factor 2
NCBI Gene Id:
1437
Protein Name:
granulocyte-macrophage colony-stimulating factor
Swissprot Id:
P04141
Protein Accession #:
NP_000749
Nucleotide Accession #:
NM_000758.3
Alias Symbols:
GMCSF,
Replacement Item:
This antibody may replace item sc-111983 from Santa Cruz Biotechnology.
Description of Target:
The protein encoded by this gene is a cytokine that controls the production, differentiation, and function of granulocytes and macrophages. The active form of the protein is found extracellularly as a homodimer. This gene has been localized to a cluster of related genes at chromosome region 5q31, which is known to be associated with interstitial deletions in the 5q- syndrome and acute myelogenous leukemia. Other genes in the cluster include those encoding interleukins 4, 5, and 13.
Protein Size (# AA):
144
Molecular Weight:
15 kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express CSF2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express CSF2.
Immunogen:
The immunogen is a synthetic peptide directed towards the C region of human CSF2
Predicted Species Reactivity:
Human
Tested Species Reactivity:
Human
Predicted Homology Based on Immunogen Sequence:
Dog: 79%; Goat: 93%; Guinea Pig: 93%; Horse: 79%; Human: 100%; Rabbit: 79%; Rat: 100%; Sheep: 93%
Complete computational species homology data:
Anti-CSF2 (ARP47967_P050)
Peptide Sequence:
Synthetic peptide located within the following region: QGLRGSLTKLKGPLTMMASHYKQHCPPTPETSCATQIITFESFKENLKDF
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
MEOX2; PABPC1; HNRNPA0; SYNCRIP; ILF3; ILF2; HNRNPA2B1; HNRNPA1; CSF2; PRG2; IL3RA; CSF2RA; KITLG; SDC2; CSF2RB;
Blocking Peptide:
For anti-CSF2 (ARP47967_P050) antibody is Catalog # AAP47967
Datasheets/Manuals:
Printable datasheet for anti-CSF2 (ARP47967_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...