Catalog No: ARP44329_P050
Price: $0.00
SKU
ARP44329_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-CSF1 (ARP44329_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Rat, Dog, Guinea Pig, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB, IHC
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human CSF1
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceDog: 85%; Guinea Pig: 85%; Human: 100%; Rabbit: 92%; Rat: 85%
Peptide SequenceSynthetic peptide located within the following region: PPTTWLGSLLLLVCLLASRSITEEVSEYCSHMIGSGHLQSLQRLIDSQME
Concentration0.5 mg/ml
Blocking PeptideFor anti-CSF1 (ARP44329_P050) antibody is Catalog # AAP44329 (Previous Catalog # AAPS14601)
Enhanced Validation
Genetic Validation Avivasheild
ReferenceWest,R.B., (2006) Proc. Natl. Acad. Sci. U.S.A. 103 (3), 690-695
Gene SymbolCSF1
Gene Full NameColony stimulating factor 1 (macrophage)
Alias SymbolsMCSF, CSF-1
NCBI Gene Id1435
Protein NameMacrophage colony-stimulating factor 1
Description of TargetCSF1 is a cytokine that controls the production, differentiation, and function of macrophages. The active form of the protein is found extracellularly as a disulfide-linked homodimer, and is thought to be produced by proteolytic cleavage of membrane-bound precursors. CSF1 may be involved in development of the placenta. The protein encoded by this gene is a cytokine that controls the production, differentiation, and function of macrophages. The active form of the protein is found extracellularly as a disulfide-linked homodimer, and is thought to be produced by proteolytic cleavage of membrane-bound precursors. The encoded protein may be involved in development of the placenta. Four transcript variants encoding three different isoforms have been found for this gene.
Uniprot IDQ5VVF3
Protein Accession #NP_757349
Nucleotide Accession #NM_172210
Protein Size (# AA)438
Molecular Weight45kDa
Protein InteractionsNOTCH2NL; SGTA; FHL3; GAB3; SOCS1; TNF; CSF1R; HLA-B; CSF1; SLA2; UBC; CBL; PIK3R2; SMARCA4;
  1. What is the species homology for "CSF1 Antibody - N-terminal region (ARP44329_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Rat, Dog, Guinea Pig, Rabbit".

  2. How long will it take to receive "CSF1 Antibody - N-terminal region (ARP44329_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "CSF1 Antibody - N-terminal region (ARP44329_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "CSF1 Antibody - N-terminal region (ARP44329_P050)"?

    This target may also be called "MCSF, CSF-1" in publications.

  5. What is the shipping cost for "CSF1 Antibody - N-terminal region (ARP44329_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "CSF1 Antibody - N-terminal region (ARP44329_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "CSF1 Antibody - N-terminal region (ARP44329_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "45kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "CSF1 Antibody - N-terminal region (ARP44329_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "CSF1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "CSF1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "CSF1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "CSF1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "CSF1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "CSF1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:CSF1 Antibody - N-terminal region (ARP44329_P050)
Your Rating
We found other products you might like!