CSEN Antibody - N-terminal region : HRP (ARP31932_P050-HRP)

Catalog No: ARP31932_P050-HRP

Size:100ul

Product Info

• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Zebrafish
• Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
• Clonality: Polyclonal
• Host: Rabbit
• Conjugation: HRP: Horseradish Peroxidase
• Application: IHC, WB
• Reconstitution and Storage: All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CSEN
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 92%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 92%
• Peptide Sequence: Synthetic peptide located within the following region: STVRHQPEGLDQLQAQTKFTKKELQSLYRGFKNECPTGLVDEDTFKLIYA
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-KCNIP3 (ARP31932_P050-HRP) antibody is Catalog # AAP31932 (Previous Catalog # AAPP02829)
• Reference: Zaidi,N.F., et al., (2004) J. Neurochem. 89 (3), 593-601
• Publications:

  Fernandes, V. S. et al. Endogenous hydrogen sulfide has a powerful role in inhibitory neurotransmission to the pig bladder neck. J. Urol. 189, 1567-73 (2013). WB, IHC, Mouse, Bovine, Dog, Pig, Horse, Rabbit, Rat, Human, Guinea pig, Zebrafish 23063804

Target Info

• Gene Symbol: KCNIP3
• Gene Full Name: Kv channel interacting protein 3, calsenilin
• Alias Symbols: CSEN, DREAM, KCHIP3
• NCBI Gene Id: 30818
• Protein Name: Calsenilin
• Description of Target: CSEN is a member of the family of voltage-gated potassium (Kv) channel-interacting proteins (KCNIPs), which belong to the recoverin branch of the EF-hand superfamily. Members of the KCNIP family are small calcium binding proteins. They all have EF-hand-like domains, and differ from each other in the N-terminus. They are integral subunit components of native Kv4 channel complexes. They may regulate A-type currents, and hence neuronal excitability, in response to changes in intracellular calcium. The protein encoded by this gene is also shown to function as a calcium-regulated transcriptional repressor, and to interact with presenilins. Mutations in the presenilin genes have been implicated in Alzheimer's disease.
• Uniprot ID: Q9Y2W7
• Protein Accession #: NP_038462
• Nucleotide Accession #: NM_013434
• Protein Size (# AA): 256
• Molecular Weight: 29kDa
• Protein Interactions: MAVS; CD177; IGLV3-25; IL6ST; IGF1R; KCND2; CLN3; CALM2; KCNIP3; PPP3CA; GRK6; ADRBK1; UBE2I; UBC; PCBD2; TARBP2; PSEN2; CASP3; CREM; CREB1; PSEN1; CRK;